tg1335

Coordinates:1259528-1260025

>tg1335 hypothetical protein TGAM_1335
MRNSIFRILRRGEKEGEEHPKKKIGLIIDGPNILRKEFGIKLEDIIEALNRIGSVRIAKVILNQYAPQGLVEAIVNQGLE
PVIVAGDTDVRVAIETMEMIYTADVDVIALASRDADFLPLIIEAKRHGKETVVIGVEPGFSVALQNAADYVIKMTPSRKA
ENEEAR

>tg1335 hypothetical protein TGAM_1335
atgaggaatagcatcttcaggatactcaggaggggcgagaaggagggtgaagaacaccccaagaagaaaatcggcctcat
catagacgggcccaacatactgcgaaaggagttcggcataaagctcgaggacataatcgaggccctaaacagaatcggga
gcgtcaggatagccaaggtgatactcaatcaatacgccccgcagggactggtcgaggcgatagtgaaccaggggctcgaa
cccgttatagttgcgggggacaccgacgtcagggtcgcgatcgaaacgatggagatgatctacaccgccgacgtggacgt
tatagcccttgcatcccgggacgcggacttcctgcccctcatcatagaggcaaagaggcacgggaaggagaccgttgtaa
ttggcgttgagcccggcttttccgttgccctccagaacgccgccgattacgtcatcaaaatgacaccctcccggaaggcc
gagaacgaggaagcccgg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1259028 - 1260525 (Additional range around tg1335 is :500nt.)

>Thermococcus gammatolerans EJ3 ATGAGCGGCAAGTGGGAGAAGATAGTCTCAATGACAAAGAGCGGCATAAGGATCATCGGCCAGATGAAGAGCAAGATATC GCGCGGCAAGAGAATAGCCCTTCTAATAGACGGTCCAAATATGCTGAGGAAAGAACTTGGCGTCAAGCTCGAGGATCTCG TTGAGGTTCTCTCCGAGATCGGGGACATCCGCGTCGCCAAGGTTGTTCTCAACCAGTACGCCCCCCAGGGGCTCATAGAG GCAGTTTCAAATCAGGGTTTTGAGCCGATGGTAGTCTCGGGCGAGACGGGAGTTAAGTTAGCTGTCGAGGCAATGAAGGA GATATACAACCCCCACATCGACGTCATCGCAATAGCCACGAGGAACGCGGAGTTTTTGCCCGTCATCCTCAAGGCCAAGG AAAAGGGAAAGGAAACGATCGTCATCGGTGTCGAGCCGGGATTTTCCGTTGCCCTGAAGCATGCGGCTGACTACGCCATA GTTCTCGGCGGTGAGAAAG atgaggaatagcatcttcaggatactcaggaggggcgagaaggagggtgaagaacacccc aagaagaaaatcggcctcatcatagacgggcccaacatactgcgaaaggagttcggcataaagctcgaggacataatcga ggccctaaacagaatcgggagcgtcaggatagccaaggtgatactcaatcaatacgccccgcagggactggtcgaggcga tagtgaaccaggggctcgaacccgttatagttgcgggggacaccgacgtcagggtcgcgatcgaaacgatggagatgatc tacaccgccgacgtggacgttatagcccttgcatcccgggacgcggacttcctgcccctcatcatagaggcaaagaggca cgggaaggagaccgttgtaattggcgttgagcccggcttttccgttgccctccagaacgccgccgattacgtcatcaaaa tgacaccctcccggaaggccgagaacgaggaagcccgg TGATGAGAATGGAATCAACGGTCGTCGTTCTTGGAACCTTT GCGGTAGGCCTGGTTCTCCTGATCAAGGGAAGCGACCTCTTCATAGAGGCCGCGGCGAGGGTTGCGAAGGGTTTCGGTGT GAGCGAGTTTTTGATAGCCCTCGTCCTCGCGAGCGTCGCGACGACCCTTCCCGAGGTTACGGTCTCGGCTTTAGCCGCCC TCAGGGGGAGCAGTGACATAGCCCTCGGCAATGCCATTGGAAGTGCGTTGGCCAACATAGCCCTGATCTTGGGCGTCGCT TCGATGATCCTTCCCCTTGACGTGGATGAAACCTCGTGGAAGCACTCCGTGTTCCTGGTGGCAATAACGGCTTACGTTTC GCTCCTTATGCTCGACGGCACAATAGGGAGGCTCGACGGTTTAAGCCTCATCCTCATCTACCTCGGATTCCTGTACTACC TTTACCGGAAGCACATGAGCCTCGAGCCCATCGAGGCAGAGCGGGGAAACCCCAAGAGG