tg1340

Coordinates:1263736-1263954

>tg1340 hypothetical protein TGAM_1340
MGVSVIRLLNDIREMRKKLDEIEQELLRLIAESEEPEIVNEELYEELLRKAEELGKNPEKGMSLEEALRELEA

>tg1340 hypothetical protein TGAM_1340
atgggagtgagtgtcatcaggcttctcaatgacatcagagagatgcggaagaagctcgatgaaattgaacaggagcttct
gaggctaatagccgagtctgaggagcctgagatcgtgaacgaggaactttacgaggaactcctcagaaaagcggaggaac
tggggaaaaacccagagaaaggcatgagccttgaggaggccctcagggagcttgaggca


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1263236 - 1264454 (Additional range around tg1340 is :500nt.)

>Thermococcus gammatolerans EJ3 CACGGTGATAGATCAGGCCCTTAATCGTCCCGTCCGTCGCGAGGAGGCCCGCCTTCCTGAGGCCCATTCCCTTCACGCGC TCCGCCGTTTCCTCGATCATACTCACTAGTGGAATTCTTATCGCCCTCTGGATTGTATCGGCGAAGAAATGGGCCGTGTT GCAGGGCATTATTATGAAGTCCGCGCCCCAGCTCTCGAGCTTCTTGGCACTGTCAATGAGCTCTGGCCTTGGATCCGGGC CCCTCCCAAGTATGAAGGCCGTTCTGTCAGGTATCTTCGGATTGTTGTAGATTATGATCCTCGGATGATCCTGATCCCTC TTTGCAGGCGTCTTCTCCACTATCCTCCTGAAGAGTTCTGCAGTCGCGAGGGGGCCCATTCCGCCGAGGATGCCGATCGT TCTCTCCATTTGCGTTCCACCGATGTAGAATGTGCCTGGAAAAATTAAGCTTTTCCAAAACCCTTTTTAATTTAACAACG TACGGGACATGGTGGGATC atgggagtgagtgtcatcaggcttctcaatgacatcagagagatgcggaagaagctcgat gaaattgaacaggagcttctgaggctaatagccgagtctgaggagcctgagatcgtgaacgaggaactttacgaggaact cctcagaaaagcggaggaactggggaaaaacccagagaaaggcatgagccttgaggaggccctcagggagcttgaggca TGAGGTGATTGAATGCCCTTTCAGGTGTGGTGGACAGGAATGTCATCAGGAACGCCAGGAAATACCTGAAAGAGAGCCAG AGGAAAAAGCTCTCGGAGTTCTTGAGGACCCTGCAGTACAATCCTTTTCCTAAACCTCCTTTCGATGTGAAGTCAGTGAA GGGAACCAAAAGTCGTCACACCAACACGTATCGGTTCGGATTGGGGATTACCGCATCTTCTACACGGTCTACTGGGAGGA AAAAGTGATAGTAGTGACGGATTTAAGACCCCGGGAAAGCGCCTATCGCTAATCCAGCCACACCGAGTCGTCTCCCTGGT AGTTGAGCTTGACCACGAACAGCCTGAAGGGCTCATCGCGCTCGTTGATCACCCAGTGGACGGTTCTCGGCTTGACGAGG AATATCTCGCCCGGTCTAGCGAGATACTCTCTATCCCCGATGCCGAGCCTTGCCTCCCCGCTCAGTATGCAGAACAGCTC GTACTGGTGAAGATGGTAGT