tg1341

Coordinates:1264045-1264746

>tg1341 Aspartate racemase (racD)
MERTIGILGGMGPLATAELFRRIVEKTPAKRDQDHPRIIIYNNPKIPDRTAFILGRGPDPRPELIDSAKKLESWGADFII
MPCNTAHFFADTIQRAIRIPLVSMIEETAERVKGMGLRKAGLLATDGTIKGLIYHRALLKRGVSIAVPGKKDQRLVMKAI
YEGIKAGNLELGRELLLKVAGKLQRRSDVIIAGCTEVSVALKPEDLSVPLIDPLDVIAEKAVKLALGLEELRTP

>tg1341 Aspartate racemase (racD)
atggagagaacgatcggcatcctcggcggaatgggccccctcgcgactgcagaactcttcaggaggatagtggagaagac
gcctgcaaagagggatcaggatcatccgaggatcataatctacaacaatccgaagatacctgacagaacggccttcatac
ttgggaggggcccggatccaaggccagagctcattgacagtgccaagaagctcgagagctggggcgcggacttcataata
atgccctgcaacacggcccatttcttcgccgatacaatccagagggcgataagaattccactagtgagtatgatcgagga
aacggcggagcgcgtgaagggaatgggcctcaggaaggcgggcctcctcgcgacggacgggacgattaagggcctgatct
atcaccgtgcactcctaaaaaggggagtaagcatagccgtgcccggaaagaaagatcagaggctcgttatgaaggccatc
tacgaggggataaaggcgggaaacctcgagctcggcagggagctactcctgaaggtggcagggaaacttcagaggaggag
cgatgtcataatagctggctgcacggaggtcagcgtcgccctgaaacccgaggatctgagcgtccccctgatcgacccgc
ttgacgtcatagccgagaaagccgtgaaactggcgctcggcctcgaggagctcagaactcca


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1263545 - 1265246 (Additional range around tg1341 is :500nt.)

>Thermococcus gammatolerans EJ3 ATACGTGTTGGTGTGACGACTTTTGGTTCCCTTCACTGACTTCACATCGAAAGGAGGTTTAGGAAAAGGATTGTACTGCA GGGTCCTCAAGAACTCCGAGAGCTTTTTCCTCTGGCTCTCTTTCAGGTATTTCCTGGCGTTCCTGATGACATTCCTGTCC ACCACACCTGAAAGGGCATTCAATCACCTCATGCCTCAAGCTCCCTGAGGGCCTCCTCAAGGCTCATGCCTTTCTCTGGG TTTTTCCCCAGTTCCTCCGCTTTTCTGAGGAGTTCCTCGTAAAGTTCCTCGTTCACGATCTCAGGCTCCTCAGACTCGGC TATTAGCCTCAGAAGCTCCTGTTCAATTTCATCGAGCTTCTTCCGCATCTCTCTGATGTCATTGAGAAGCCTGATGACAC TCACTCCCATGATCCCACCATGTCCCGTACGTTGTTAAATTAAAAAGGGTTTTGGAAAAGCTTAATTTTTCCAGGCACAT TCTACATCGGTGGAACGCAA atggagagaacgatcggcatcctcggcggaatgggccccctcgcgactgcagaactctt caggaggatagtggagaagacgcctgcaaagagggatcaggatcatccgaggatcataatctacaacaatccgaagatac ctgacagaacggccttcatacttgggaggggcccggatccaaggccagagctcattgacagtgccaagaagctcgagagc tggggcgcggacttcataataatgccctgcaacacggcccatttcttcgccgatacaatccagagggcgataagaattcc actagtgagtatgatcgaggaaacggcggagcgcgtgaagggaatgggcctcaggaaggcgggcctcctcgcgacggacg ggacgattaagggcctgatctatcaccgtgcactcctaaaaaggggagtaagcatagccgtgcccggaaagaaagatcag aggctcgttatgaaggccatctacgaggggataaaggcgggaaacctcgagctcggcagggagctactcctgaaggtggc agggaaacttcagaggaggagcgatgtcataatagctggctgcacggaggtcagcgtcgccctgaaacccgaggatctga gcgtccccctgatcgacccgcttgacgtcatagccgagaaagccgtgaaactggcgctcggcctcgaggagctcagaact cca TGACCATTCCGGAGTGCAGCTTGCGGAAACGCTCGCCGTATGCCTTCAGGAAAGCCGTCTCGGCCTTCAGCCCGGT GCAGTGCCCGGTGTAGACTTCTTTAACGCCGAGCTCTTTGAACTCCTCCACAGTTCTCTTGATGCGCTCGTCGCTTGCCT CAATCAGGTGAAAGCCGCCTATTACAGCCCTGACACGCTCCTCGCCTGTTAGCCGTATCGCGTGCTTGACGATGCTAACT ATGCCGGCGTGGCTGCAGCCGCTTATAACCACGAGACCCCCCGGCGTTTTCGCCACGAGACTCATGTCATCCCTCAGCCT GTCCCCCACGACCTTCCCGTTCTCAATTGTGTAGACTTCAAGCTCTGTTCTCTCAAACTCCTCCCGCTCGGTTACTTCAC CCGTTGAGAGGACGTTCTCGGTTATTGGAAGAGGGTCTGCGGTGAGGTAGAGGTCAGCGAGCTCCTCAACTTCCTCCCGC CTGAACGGAACGCCCACCTCGCG