tg1345

Coordinates:1267561-1267845

>tg1345 hypothetical protein TGAM_1345
MGREITDEKLERYFRITEEALKTLEVAVHEKSLLHKVAEDFLTMARSYFEDARYYYEKGDYVTAFAALNYAHGFIDAGVR
LGVFRGEDDRLFAFG

>tg1345 hypothetical protein TGAM_1345
gtggggcgagagatcaccgatgagaagctcgagaggtattttagaataacagaggaggccttaaagacccttgaggttgc
agttcatgagaaaagcctccttcacaaagttgctgaggattttttgacgatggcgaggagctattttgaggacgccaggt
attactacgagaagggcgactacgtgacggccttcgcggcgctgaattacgcccacggctttatcgacgccggtgtaagg
ctcggtgtctttaggggtgaagacgacaggctttttgccttcggg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1267061 - 1268345 (Additional range around tg1345 is :500nt.)

>Thermococcus gammatolerans EJ3 CCTCTATCTCCGTTCGAAGAATCTTCTCCCACTGTTTGACGGGATTTCCGTCGGTGATTATCCCCAGTTTAAGACCCATC TCTTTGAGGCGAAGGAGGGTCCTCTTAACTCCCCGTACGGTCTTGAGGTGGGAGATCTTAGTGTTGTGGTAACCTATTAC TCCCGCCGCTATCCACCTGGGGTTGTGAGGGAGATCGAGGCGCCTCAGGAGGTAGTCGAAGTGCCTGTTGAAGTTGCTCC CGTACTCGTTTATCAGCTCAAGGAGCTCATGGTAGGCTATGCCGAAATCGACGGGCATACCGGCACGGATCATATTCTCT ATCGCGTTTCGCCTTGCGATCTCGGCGAGTTTGCTTGTGTCGATGAGCGTGTCGTCAAGGTCAAAGAAAACGACCTTTAT CATGGCCTCACCCCTCTGACCTAGGGGGTTCAGATATTTAACGGTGATGGTGGGCAAGGTTTATAAAACCGGGGCCCAAC CCTCAGCGAGGCGAGACCG gtggggcgagagatcaccgatgagaagctcgagaggtattttagaataacagaggaggcc ttaaagacccttgaggttgcagttcatgagaaaagcctccttcacaaagttgctgaggattttttgacgatggcgaggag ctattttgaggacgccaggtattactacgagaagggcgactacgtgacggccttcgcggcgctgaattacgcccacggct ttatcgacgccggtgtaaggctcggtgtctttaggggtgaagacgacaggctttttgccttcggg TGAGGTGGGACCAT GGGGGACTACGTCGTTGTGCTCGAAGCCCCGATAATAGTCAAGGATGTGGAAACGAGCGAGGACGCGATAAACGTCGCGG TGAGCAAGGTCGCAAAGGCCCTCAACAAGGAGAACCTCGACTTCGTGAGGGTTGAGATTGGCTACTCCCAGTGCCCCGTC TGCGGCGCCCATTTCGAGAGTGCCTTCGTGATAGGCTCCGTCGGGCTGGTTGGGATATACCTCACGCTCAAGGTCTTCAA CGCCCAGAGTATAGAGCACGCCGAGAGAATAGCCAAGGCCGTGGTTGGAAAGGCCCTCAAGAGGGTTCCACTCAAGGTTT TTGAAATAAGGGAGCTGGAGGAGGAGAATGGGGACGGTCTGGAGGTTCCGGACGAGTTCGAATGAGCGGCAACTTTTTAT TATCCCCCTCGATTCCACTCCGGGTGAAGGAATTGAAGGTCAGGTTACTCGTGCTCATCCTTCTGCTCTCAACTGCCAGC CTCGCC