tg1349

Coordinates:1269860-1270318

>tg1349 Small multi-drug export protein, putative
MNGFIEVFLLSLIPTFEGRYAIVYGIGRGYPLWETLLSASLGVLLLSLLLPLALPLIDRIMLWLEKTPLRKVAHLYLYYV
ERARRKAHPYVERWGFIGLTIFVAIPLPGTGVWTGALAAYLLGIEKKQTVPALILGGLLSMAITVLPALGLFG

>tg1349 Small multi-drug export protein, putative
atgaacggtttcatcgaggtcttcctgctatccctcattccaaccttcgaggggcgctatgcgatagtctatggcatagg
gaggggctatcctctctgggagacccttctgagcgcttccctcggcgttctgctactctcgctcctcctgcctttggcgc
ttccactgatagaccgaatcatgctctggctcgaaaaaacgcccctccgaaaggtggcccacctctacctctactacgtc
gagcgtgctcggagaaaggcccacccctacgtggaaaggtggggcttcatcggcctcacaatcttcgttgccattccgtt
gccagggactggtgtgtggacgggagcattggcggcttacctcctcggaatcgagaaaaagcagacggttcccgctttaa
tcctcggcgggcttttgagcatggcgataacggttctgcccgcgctggggctgtttggg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1269360 - 1270818 (Additional range around tg1349 is :500nt.)

>Thermococcus gammatolerans EJ3 ATAGACACTCCCTGGATGAACCTGCTAACGGCCCTGGGGGGAAACGCGTTCTTAGCCCTTTTTGCCATCATTGTAGTTCT CTACGAGATGAAGAAGCTGGGTGGCGTATCTTCAAAGACCCTTGCCTTTCTCATCGCTCTCTCCCTCGGCCTCGTCGCGG TCGGTGCGCTGAAGGCCCTCCTCGCCGAGCCAAGACCGAGACCGCTCCCGGGGGCCGGTTTTCTGAGCTCGGGGGCGTTC CCCTCGGGCCACACCTTCAGAGCCTCAATAATAGCGAGCTACGTTTCAGACCGCTGGAAGAAACTTGCTCCGCTCGCGTG GGCCTACGCCATTGGAATAGCCCTCACGAGGCTCTTCCTCCACTACCACTGGCTTAGCGACGTCCTTTTCAGCCTCCTCT TTGCCCCCTGGCTTTATCTACTGCTCCGCTCCACGGAGAAACTCTGGCTTCCCATCATGGGGAGAATACTCAAAAAACTC AACCTGGAGGTCGTTGAGGC atgaacggtttcatcgaggtcttcctgctatccctcattccaaccttcgaggggcgcta tgcgatagtctatggcatagggaggggctatcctctctgggagacccttctgagcgcttccctcggcgttctgctactct cgctcctcctgcctttggcgcttccactgatagaccgaatcatgctctggctcgaaaaaacgcccctccgaaaggtggcc cacctctacctctactacgtcgagcgtgctcggagaaaggcccacccctacgtggaaaggtggggcttcatcggcctcac aatcttcgttgccattccgttgccagggactggtgtgtggacgggagcattggcggcttacctcctcggaatcgagaaaa agcagacggttcccgctttaatcctcggcgggcttttgagcatggcgataacggttctgcccgcgctggggctgtttggg TGATGCTATGGTGGGGCTCAATCCATTAAGCGTTGAGATAAGCTCTGGAAATCCCTTAGATCTCCTACAAGCCAGCCCC TTTCCCTCAGCGCTTCCTTTTCTTCAACGTTCTTCGCAACCAGCCCGTAAGTCCTCCCCCAGTCTTCCAGTCCCACAAGC CCAGCCTTTCTCTCAAGGTCTCTTAAAATCCCTCTCGCCTCCCTCCCGCTTAACTCCTTCCACTTGACCTCAGCGAAGAG CGCCCGCTTTTCCCGCTCGTTCAGGGCAACCAAATCAATCTCCTCTCCCTTCCTCCACCAGCGACCGAGCTTCGTGAAGC GGAAGCCCGTCAGCTTGAGAAACACCTCAGGATTCCTCACCAGTCTCTCGAAAACCGAGCCGAGGTAGAGGTTGAAGTCC TCCCCCGAGCGCTCCCAGACTTCCTCCGCAAGGCCGGCTTCAAGGTAGCTCTTGTTCGGGAGCACGTAGCGGAACCAGAA GGCGAAGTAGTTGTCGGCTA