tg1372

Coordinates:1293599-1294057

>tg1372 hypothetical protein TGAM_1372
MIINETKGRVWHGHVELADTFIKRFRGLMLVSNVNHALIFVLPIENRLNASIHMFFMLSDIDVIWLDSMRRVVDFKTARR
WRIYTPKESARYVIEGPVGLIRTLDVEEGDLISWDVTEKKEKSVPVKVSFPGKISFENERNTVVFSKDIIELP

>tg1372 hypothetical protein TGAM_1372
atgataatcaacgagacgaagggcagggtctggcacgggcacgttgagctcgccgatactttcatcaagcgctttagggg
tctaatgcttgtaagcaacgtaaaccacgccctcatctttgtcctacccattgagaacaggctcaacgcttcgattcaca
tgttcttcatgctgagcgacatcgacgtaatctggctcgactcaatgagacgagttgtggatttcaagactgcccggagg
tggaggatttacactccgaaggagtcagccaggtacgtcatcgagggaccagtggggctcatcagaacccttgatgttga
ggagggcgatctgataagctgggatgttacagagaaaaaagaaaaatccgtgccagttaaggtctcttttccggggaaaa
tttcgtttgaaaatgaacggaatacagtagtttttagtaaggacattattgaactaccc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1293099 - 1294557 (Additional range around tg1372 is :500nt.)

>Thermococcus gammatolerans EJ3 TTGAGGAGCTCGTTGACCTTCCTCGTGTCCTCCTCAATCTTCCTCAGCAGGGCCAGGCGGAGGTTCATGAGGGCGTTAAT TCTCTTCTCGATGTTCTCCCTGGCCTCGTCAACCGTTGCCCCGACGAGGATTCCAGCTCCAACGTCCATGATGACGTCGT CAGGGTTCTCAATCTTGCCCTTTATCGCTATGCCGCTCCCGAGCGGGATGTAAATTGGCTTGCCCTTACCCTTGTCCTTG AGGTAAGCGAGGGTTGCATCGACAGTCCTGAGGTCGGCGATGGTGGCGTCTATCACTCCAATCTGGCTCCTGAGGTACTC GATTTCGCCGAGGTAGCTCCTTATCTCGTCCTGAATCTGCTCAAGGGTCCTAACCTTCTTCTCCTCGGCCATTTCCACCA CCTCCGTTCCTTTTTTCGCTCCCATATTTTAGTTACCTTTTGTATTTAAAAGTTTTTCGCCTCACAAGGCTTATTAAGGG GCGGGGTCAAGCTTAAACC atgataatcaacgagacgaagggcagggtctggcacgggcacgttgagctcgccgatact ttcatcaagcgctttaggggtctaatgcttgtaagcaacgtaaaccacgccctcatctttgtcctacccattgagaacag gctcaacgcttcgattcacatgttcttcatgctgagcgacatcgacgtaatctggctcgactcaatgagacgagttgtgg atttcaagactgcccggaggtggaggatttacactccgaaggagtcagccaggtacgtcatcgagggaccagtggggctc atcagaacccttgatgttgaggagggcgatctgataagctgggatgttacagagaaaaaagaaaaatccgtgccagttaa ggtctcttttccggggaaaatttcgtttgaaaatgaacggaatacagtagtttttagtaaggacattattgaactaccc TAGGGAGGGTCCTGTTTCATAACAATTTCCGTAATATTTTTAATTAGTAAGTTGAGCTCTTAGTGGGTGATCTGTCATGA GAGGCAACACAAGGAGCATTTTGGCGTTGTTCCTTACATTGGTTTTTGTTCTCTCAATGGCCACACTCTCAAGTGGATGC ATTGGGGGGAGCAATGACAGCAAGGAATGGGTGAAGCTAGTTCCCAAGGGCTCGTTTGCCGCGTTTTACGTTGACGCCAA AATACTCTCTGATGAAAGTACCGAATCTTTGATGAGGGCGCTGGATGTTTACCATGACTATAAAAAGGCTCTTAATGAAA TTGAGGATTCCACCAACGTAAGTCCCTCTGATGTGGAGTGGGGACTTTTCGTCCTTTACGACCTTAGCCTCAATGAGGAG GGAGACGTAGAGGCTATTGATTTTGCAGTTTACATCAAAGGAAAATTCAACACTAAGGATCTAGTTAAACGACTAAAGAA CAGCACAGAGGGTATCAGAG