tg1373

Coordinates:1294165-1294590

>tg1373 Prefoldin alpha subunit (pfdA)
MAEEKKVRTLEQIQDEIRSYLGEIEYLRSQIGVIDATIADLRTVDATLAYLKDKGKGKPIYIPLGSGIAIKGKIENPDDV
IMDVGAGILVGATVDEARENIEKRINALMNLRLALLRKIEEDTRKVNELLKELQEMQPEKKE

>tg1373 Prefoldin alpha subunit (pfdA)
atggccgaggagaagaaggttaggacccttgagcagattcaggacgagataaggagctacctcggcgaaatcgagtacct
caggagccagattggagtgatagacgccaccatcgccgacctcaggactgtcgatgcaaccctcgcttacctcaaggaca
agggtaagggcaagccaatttacatcccgctcgggagcggcatagcgataaagggcaagattgagaaccctgacgacgtc
atcatggacgttggagctggaatcctcgtcggggcaacggttgacgaggccagggagaacatcgagaagagaattaacgc
cctcatgaacctccgcctggccctgctgaggaagattgaggaggacacgaggaaggtcaacgagctcctcaaggagctcc
aggagatgcagcctgagaagaaggag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1293665 - 1295090 (Additional range around tg1373 is :500nt.)

>Thermococcus gammatolerans EJ3 CGGAAAAGAGACCTTAACTGGCACGGATTTTTCTTTTTTCTCTGTAACATCCCAGCTTATCAGATCGCCCTCCTCAACAT CAAGGGTTCTGATGAGCCCCACTGGTCCCTCGATGACGTACCTGGCTGACTCCTTCGGAGTGTAAATCCTCCACCTCCGG GCAGTCTTGAAATCCACAACTCGTCTCATTGAGTCGAGCCAGATTACGTCGATGTCGCTCAGCATGAAGAACATGTGAAT CGAAGCGTTGAGCCTGTTCTCAATGGGTAGGACAAAGATGAGGGCGTGGTTTACGTTGCTTACAAGCATTAGACCCCTAA AGCGCTTGATGAAAGTATCGGCGAGCTCAACGTGCCCGTGCCAGACCCTGCCCTTCGTCTCGTTGATTATCATGGTTTAA GCTTGACCCCGCCCCTTAATAAGCCTTGTGAGGCGAAAAACTTTTAAATACAAAAGGTAACTAAAATATGGGAGCGAAAA AAGGAACGGAGGTGGTGGAA atggccgaggagaagaaggttaggacccttgagcagattcaggacgagataaggagcta cctcggcgaaatcgagtacctcaggagccagattggagtgatagacgccaccatcgccgacctcaggactgtcgatgcaa ccctcgcttacctcaaggacaagggtaagggcaagccaatttacatcccgctcgggagcggcatagcgataaagggcaag attgagaaccctgacgacgtcatcatggacgttggagctggaatcctcgtcggggcaacggttgacgaggccagggagaa catcgagaagagaattaacgccctcatgaacctccgcctggccctgctgaggaagattgaggaggacacgaggaaggtca acgagctcctcaaggagctccaggagatgcagcctgagaagaaggag TGACTTCTCCTCGGCCATTCTTTTTTATTGGG GGTGAGAGCGTGGAGGCGGTGAAGGCTTACGAGCTCGAACTTGAGCTCAGGCAGATAAGGGAGCTCAGGAAGGCGATAGA GCTCAAGATGAAGGAACTCGAGTACGCAGAGGGAATCATAACGGCCACCAAGGCCGAGAGGAAGCTCTACAGGGCCTTCG CAGACCTGCTCGTTGAGGTAACGAAGGACGAGGCAATCGAGCACATCGAGAGAATGCGCCTGGCTTACAAGAGGGAAATC GAAAGGCTCAGGGAGAAAGAGAAGGAGATAATGGAGAAGCTCTCAAGGCTCAGCTCCTGAGCTCCTCCGCTATCTCAAAG CCCTTCTTGAGGGCTTTAACATTTATCTCCTCCGTTCCTTTGGGAACCGCATCGCGGACGGCCTTCTCTATTGCTTCCCT GCCCACTATCCCTGTCACGCCGACGAGTATGCCGAGGGTTAGAATGTTCATCGTCAGGCTTAGCCCG