tg1374

Coordinates:1294590-1294919

>tg1374 Prefoldin beta subunit (pfdB)
MTSPRPFFFIGGESVEAVKAYELELELRQIRELRKAIELKMKELEYAEGIITATKAERKLYRAFADLLVEVTKDEAIEHI
ERMRLAYKREIERLREKEKEIMEKLSRLSS

>tg1374 Prefoldin beta subunit (pfdB)
gtgacttctcctcggccattcttttttattgggggtgagagcgtggaggcggtgaaggcttacgagctcgaacttgagct
caggcagataagggagctcaggaaggcgatagagctcaagatgaaggaactcgagtacgcagagggaatcataacggcca
ccaaggccgagaggaagctctacagggccttcgcagacctgctcgttgaggtaacgaaggacgaggcaatcgagcacatc
gagagaatgcgcctggcttacaagagggaaatcgaaaggctcagggagaaagagaaggagataatggagaagctctcaag
gctcagctcc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1294090 - 1295419 (Additional range around tg1374 is :500nt.)

>Thermococcus gammatolerans EJ3 TTGTGAGGCGAAAAACTTTTAAATACAAAAGGTAACTAAAATATGGGAGCGAAAAAAGGAACGGAGGTGGTGGAAATGGC CGAGGAGAAGAAGGTTAGGACCCTTGAGCAGATTCAGGACGAGATAAGGAGCTACCTCGGCGAAATCGAGTACCTCAGGA GCCAGATTGGAGTGATAGACGCCACCATCGCCGACCTCAGGACTGTCGATGCAACCCTCGCTTACCTCAAGGACAAGGGT AAGGGCAAGCCAATTTACATCCCGCTCGGGAGCGGCATAGCGATAAAGGGCAAGATTGAGAACCCTGACGACGTCATCAT GGACGTTGGAGCTGGAATCCTCGTCGGGGCAACGGTTGACGAGGCCAGGGAGAACATCGAGAAGAGAATTAACGCCCTCA TGAACCTCCGCCTGGCCCTGCTGAGGAAGATTGAGGAGGACACGAGGAAGGTCAACGAGCTCCTCAAGGAGCTCCAGGAG ATGCAGCCTGAGAAGAAGGA gtgacttctcctcggccattcttttttattgggggtgagagcgtggaggcggtgaaggc ttacgagctcgaacttgagctcaggcagataagggagctcaggaaggcgatagagctcaagatgaaggaactcgagtacg cagagggaatcataacggccaccaaggccgagaggaagctctacagggccttcgcagacctgctcgttgaggtaacgaag gacgaggcaatcgagcacatcgagagaatgcgcctggcttacaagagggaaatcgaaaggctcagggagaaagagaagga gataatggagaagctctcaaggctcagctcc TGAGCTCCTCCGCTATCTCAAAGCCCTTCTTGAGGGCTTTAACATTTA TCTCCTCCGTTCCTTTGGGAACCGCATCGCGGACGGCCTTCTCTATTGCTTCCCTGCCCACTATCCCTGTCACGCCGACG AGTATGCCGAGGGTTAGAATGTTCATCGTCAGGCTTAGCCCGGTGGTTTCTTCCGCTATCTCGGTCAGAGGCAAAGCGAT GACGTTGAGCTTCTTCTCGAACTCCAGGTCCCTGTGGGGGACGAGGTCCTTCTCGACTATTACAGTGGTGCCTTCCTTTA CCGTGTGGAGGTACTTGCTGTAGGCCTCCTGCGAGAAGAAGACTGCATAGTCAGGATGAAGTGTCTTGGGGTAGTCAATC GGCTCGTCGCTTATAACCACTTCTGCCCTGCTCGCACCTCCCCTCGATTCCGGCCCGTAGCTCTGGGTCTGGACCGCGTA GAGGTTCTCATAGACAGCAGCCGCTCTTCCGAGGATGACGCTCGCGAGTAT