tg1378

Coordinates:1297453-1297656

>tg1378 hypothetical protein TGAM_1378
MKIEYSQDADVLIIRLRDDEVVDSVDLGEGVIAHLNEKGEVVEIEILDASKSVDFRELVLRIPSGVVA

>tg1378 hypothetical protein TGAM_1378
atgaagatagagtactcgcaagatgctgacgtcttgattatccgccttagagatgacgaagttgttgattcagttgacct
cggtgaaggtgtcatcgcgcacctgaacgagaaaggagaagtcgttgagattgaaatcctcgatgcgtccaagtccgttg
acttcagggagcttgtcctcaggattccgagtggggtggtagca


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1296953 - 1298156 (Additional range around tg1378 is :500nt.)

>Thermococcus gammatolerans EJ3 AATCGCCGAGGAGACCACTGGGCTCGCCCTAACAGTAAACATGGTCACTCTCGGCTACCTTGTTGCGAAAACCAATGTTG TGAAGAAGGAGAGCGTTGAGGAAGCGATTAGGAGGCGCGTCCCGAAGGGGACTGAGGAGATAAACATCAAGGCCTTCAGG GCCGGTTATGAGGAGGGGCTGAAGTGAAGGTTGTTGAGGAGAGGAACCACCCCAAAGGCAGAATCATAGTAATTCAAACA GACGAAAAAGAGTGCCAAATCCTGATAACACATCACGCACTTTCCCGTGCAAGGCGCTGGAAACTCTCGCTTGAAAAGCT CGTGGAAGCGATACTGTATCCTGAAGAGGTCCTAATGGGGCACCACGACAGGTTTATAGCACATAAAGCAGAGAATAGCC ATATTATCAGGGTTATCTACGAGTATGAGAATGGCGTTCCCGTGGTTGTGACGGTGTATAGACCGCGTAAAGAGCGTTAT TTCATAGGTGGTGGTGTTT atgaagatagagtactcgcaagatgctgacgtcttgattatccgccttagagatgacgaa gttgttgattcagttgacctcggtgaaggtgtcatcgcgcacctgaacgagaaaggagaagtcgttgagattgaaatcct cgatgcgtccaagtccgttgacttcagggagcttgtcctcaggattccgagtggggtggtagca TGAGGTACCCGTTTC CGGTCGGCAAGTCCGACTTCATTCAAGGTGATGAGGCCATAGCGAGGGCGGCTATCTTAGCTGGTTGCAGGTTCTACGCG GGCTACCCAATAACGCCCGCCAGCGAGATATTCGAGGCGATGGCCCTCTACATGCCCCTCGTTGACGGTGTGAGCATACA GATGGAGGACGAGATAGCGAGCATAGCGGCGATAATAGGCGCCTCCTGGGCTGGGGCGAAGGCGATGACCGCAACGAGCG GGCCTGGCTTCTCGCTGATGCAGGAGAACCTCGGCTATGCTGTAATGACCGAGACGCCGATAGTCGTCGTCAACATGATG CGCGGTGGTCCATCAACGGGCCAGCCAACGTTCCCGGCCCAGGGAGACATAATGCAGGCCATCTGGGGCACTCACGGCGA TCACATGCTCATCGTTTTAAGTCCCTCAACCGTTCAGGAAGCCTTTGACTTCACTATTAGGGCCTTCAACCTGGCCGAGA AGTAC