tg1388

Coordinates:1304497-1305294

>tg1388 Acid phosphatase SurE (surE)
MRILLTNDDGIYSNGLRAAVKALSELGEVYVVAPLFQRSASGRAMTLHRPIRAKRVDVPGARIAYGIDGTPTDCVIFAIA
RFGSFDLAVSGINLGENLSTEITVSGTASAAIEASTHGIPSIAVSLEVDWKKTLGEGEGVDFSVSAHFLRRIAGAVLERG
LPEGVDMLNVNVPSDATEDTKMAITRLARKRYSPTVEERIDPKGNPYYWIVGRLVQDFEPGTDAYALKVERKVSVTPINI
DMTARVDFEKLKNVLFGESLQTGRTY

>tg1388 Acid phosphatase SurE (surE)
ttgagaatcctcctcaccaacgacgacggaatctactcaaacggcctgcgcgcggcggtaaaggctctcagcgagctcgg
cgaagtttacgtcgttgcccccctcttccagaggagtgcaagcggcagggccatgacgctccacaggccgataagggcca
agcgcgttgacgtccccggcgcgaggatagcctatgggatagacgggacgccaacagactgcgtgattttcgccatagcc
cgcttcgggagctttgatttagccgtcagcgggattaacctcggcgagaacctcagcacggagataacagtctcggggac
ggcctcagcggcgatagaggcatcaacccacgggattccgagcatagcggtgagtcttgaggtggactggaagaagaccc
ttggtgagggtgagggagtggacttctcggtctcggctcatttcctcaggagaatagccggtgcagtccttgagaggggc
cttcctgagggcgttgacatgctcaacgtcaacgtcccgagcgacgctacggaggacacgaagatggcaatcacccgctt
agccaggaagcgctactccccaacggtcgaggagaggattgacccgaagggcaacccatactactggatcgtcggcagac
ttgttcaggacttcgagccgggaaccgatgcgtacgccctaaaggtcgagaggaaggtcagcgttacgccgataaacatc
gacatgactgcgagggtggattttgagaaacttaaaaacgttctttttggtgaatctttgcagactggaaggacgtat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1303997 - 1305794 (Additional range around tg1388 is :500nt.)

>Thermococcus gammatolerans EJ3 CCTCCAAATCTTGGCAGGAGCTGGAGGCAGAGATGTATGATGAGCTTGTTCCTTGACAGCAACGTGTTCATTGAGTATCT CAAAGGGAATCCAAACGCGTCTGCTCTTCTCTCTCGTTTAGCAGATGGAGAGTTCAGACTGTTCACAAATGAGACGGTTT ATAATGAGGTTCTCTTCACGTATCTACGTTCGAATATTGGGGGATACTGGACCCTTAAACGGAGTCGAGATGAAGTTAAA CGAATTGCGAGAATCTTTGTCCATCAGGTTCTACCAATGCTGAGTTCGACAAATTTTCTTGACACGAATCATGAAATTGT CCTTTTGTCAATCAAATTCACCGTGGAATATGGCCTTCTTCCGAGTGATGCCCTAATCTTGGCAACTGCCAAGTACTATG GCCTTGACGGGGTAGTAAGCCTTGACTCCGACCTGCTTACCGTTGCACCGCGGGAAGGTCTTTTGGCTATTTCAAAAGTT GAGGATCTGGAGGTGTAGGC ttgagaatcctcctcaccaacgacgacggaatctactcaaacggcctgcgcgcggcggt aaaggctctcagcgagctcggcgaagtttacgtcgttgcccccctcttccagaggagtgcaagcggcagggccatgacgc tccacaggccgataagggccaagcgcgttgacgtccccggcgcgaggatagcctatgggatagacgggacgccaacagac tgcgtgattttcgccatagcccgcttcgggagctttgatttagccgtcagcgggattaacctcggcgagaacctcagcac ggagataacagtctcggggacggcctcagcggcgatagaggcatcaacccacgggattccgagcatagcggtgagtcttg aggtggactggaagaagacccttggtgagggtgagggagtggacttctcggtctcggctcatttcctcaggagaatagcc ggtgcagtccttgagaggggccttcctgagggcgttgacatgctcaacgtcaacgtcccgagcgacgctacggaggacac gaagatggcaatcacccgcttagccaggaagcgctactccccaacggtcgaggagaggattgacccgaagggcaacccat actactggatcgtcggcagacttgttcaggacttcgagccgggaaccgatgcgtacgccctaaaggtcgagaggaaggtc agcgttacgccgataaacatcgacatgactgcgagggtggattttgagaaacttaaaaacgttctttttggtgaatcttt gcagactggaaggacgtat TAATGGGAACTGGGAAGATGCAGACATAATAGAGGTGAGGGCCTCATGAGAGGGAAACAT TCAAAGCGGCTTCTTTTTACATTTTTAGTCCTCATAGTCGTTGCCGTACTACTGATAAGAACACCACTTTCCTTCCGCCA GACTCTTTAAATGAGCTCAACACATCCGATGCACAATCCCGCGCCTTTGAAGTTCTTAGCGAGATGCTCACCCACTTTAG CTCAAGGCAGGAGAGGAAATGGCTTCCCTACAACGTCTCGGGTTATGAGGAAGGCTTTGAGGGCATTGTCTCCAACGGCA CTTCCAGCTTTGAAGTTGCCGTTTTTGTTTACGGAAACCTGAGCGAGTGCCGGAAACTGTTCAAGAGCATTGAAAACGAC CTAAAATCCTCACTCGCCGTCGTGAACAGCTCCGAAGGAGAGTCATGCATATGGAGGCTGTTCTCCGGAAACAAAAGCTA TTACATCGAGTGCAGCGGGTTCTGGAATAAGAGTGTCCT