tg1389

Coordinates:1305498-1305896

>tg1389 hypothetical protein TGAM_1389
MLTHFSSRQERKWLPYNVSGYEEGFEGIVSNGTSSFEVAVFVYGNLSECRKLFKSIENDLKSSLAVVNSSEGESCIWRLF
SGNKSYYIECSGFWNKSVLLVVRGSDEKAVERLTWWFPTQNCLRPGTRLVVQT

>tg1389 hypothetical protein TGAM_1389
atgctcacccactttagctcaaggcaggagaggaaatggcttccctacaacgtctcgggttatgaggaaggctttgaggg
cattgtctccaacggcacttccagctttgaagttgccgtttttgtttacggaaacctgagcgagtgccggaaactgttca
agagcattgaaaacgacctaaaatcctcactcgccgtcgtgaacagctccgaaggagagtcatgcatatggaggctgttc
tccggaaacaaaagctattacatcgagtgcagcgggttctggaataagagtgtcctcctcgttgttaggggaagcgacga
aaaagccgttgaaaggctcacctggtggtttccaacgcagaactgcctcagacccggaaccagactcgtggttcagacg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1304998 - 1306396 (Additional range around tg1389 is :500nt.)

>Thermococcus gammatolerans EJ3 CTCAACGTCAACGTCCCGAGCGACGCTACGGAGGACACGAAGATGGCAATCACCCGCTTAGCCAGGAAGCGCTACTCCCC AACGGTCGAGGAGAGGATTGACCCGAAGGGCAACCCATACTACTGGATCGTCGGCAGACTTGTTCAGGACTTCGAGCCGG GAACCGATGCGTACGCCCTAAAGGTCGAGAGGAAGGTCAGCGTTACGCCGATAAACATCGACATGACTGCGAGGGTGGAT TTTGAGAAACTTAAAAACGTTCTTTTTGGTGAATCTTTGCAGACTGGAAGGACGTATTAATGGGAACTGGGAAGATGCAG ACATAATAGAGGTGAGGGCCTCATGAGAGGGAAACATTCAAAGCGGCTTCTTTTTACATTTTTAGTCCTCATAGTCGTTG CCGTACTACTGATAAGAACACCACTTTCCTTCCGCCAGACTCTTTAAATGAGCTCAACACATCCGATGCACAATCCCGCG CCTTTGAAGTTCTTAGCGAG atgctcacccactttagctcaaggcaggagaggaaatggcttccctacaacgtctcggg ttatgaggaaggctttgagggcattgtctccaacggcacttccagctttgaagttgccgtttttgtttacggaaacctga gcgagtgccggaaactgttcaagagcattgaaaacgacctaaaatcctcactcgccgtcgtgaacagctccgaaggagag tcatgcatatggaggctgttctccggaaacaaaagctattacatcgagtgcagcgggttctggaataagagtgtcctcct cgttgttaggggaagcgacgaaaaagccgttgaaaggctcacctggtggtttccaacgcagaactgcctcagacccggaa ccagactcgtggttcagacg TGAGATACTCTCACAACCAACCCTGAAAATTGGAACCTATTAATGGTATAGATTCCCTT CCGGAAATATTTTGTGAGCCCTAGGTTTTTCACGATGTAAAACCTTTGGGATTCACAAAATTTATAACTTCCGGAGGGAT ATTCTAACCGGTGAACGCCATGAAGCGGCTAGCAACCATCATAGCAGCTTTCGTGTTGTTTAGCGTTTTTGGGTTTGCTA TGGCCAGCGCAACAACCGTTGCAGTGGACTTAACTCACGGTGAAAACACCAAGTATCTCGTTGACCCAGTTGTTGACAGG GACAATCAGAGCCACATTCTTGCGCCTTCGATCGTCGAAGGCGTTGGAGACATGGAGTGGGCCTACTTTGGAAGCCCGGA CATGTTCCCCAACAACACCAAGATCAAGAACTTGGGGGACACCATAACCCCCGATGCCCTCAAGGACGTTGACGTCCTTA TCCTCGGCCAGCCAACCAGTCCATTCACACCGGAGGAGAT