tg1393

Coordinates:1310377-1310637

>tg1393 LSU ribosomal protein L35AE (rpl35AE)
MRRKALILAYAGSHEHRHNHHMILKPIGVEDRAGASALIGRKVVWRTPTGRKMFGKILRVHGNRGEVKAYFKPGLPGQAL
GDYVEIL

>tg1393 LSU ribosomal protein L35AE (rpl35AE)
atgaggcgaaaggccctgatcctcgcctacgccggttcccacgagcacagacacaaccaccacatgattctcaagccaat
cggcgttgaagacagggcgggggcgagcgccctcatcggcagaaaggtggtgtggaggacaccgaccggcaggaaaatgt
tcgggaagattctgagagttcacggtaacagaggggaggtcaaggcatactttaagcccggccttccaggtcaggccctc
ggcgattacgtcgaaatcctt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1309877 - 1311137 (Additional range around tg1393 is :500nt.)

>Thermococcus gammatolerans EJ3 CTCGACGATGCTTCCGGGCTCGACGACACTTTCCCCAAAGAACCGTCTCAAAAGCTCGGGATCGTCCTCGTTGCCTGGAA CTATGTAAAGCTTCGCTCTAGAGCCCTTGAGAATCCGCGCGAGCTTTCTCAGGCCTGCTTCATAAGCTGGCTTTAGGTCA GGTCTCCGCTCCAGCTTGATGTTGTCAACTAAATCGCCCGTGTGGATTATCACATCTGGCCGAGCCTCTCCGATGAGACC TTTGAGAAAGGGATAAACGCGCTCTGGCGTGTCCCCTATGTGCATGACGAGGGTTTCTCCTGAATTCTGTCTGAGCTTTC TAAGCTTTCTCCTCCTCAGGAAGCCGAGCATCGGGAGCACTGATGAACGTTGGTTGGTTTGTGTATATTACCGTTTCTCC TCTTAACGGCAGGCAATCCAGCGAACGGGTCGATCTTGGGGTGGGGCTGGAAATAACATTTAAAAATCCACGTTTCCCTA TCAGCTTGGGGTGAGGGTC atgaggcgaaaggccctgatcctcgcctacgccggttcccacgagcacagacacaaccac cacatgattctcaagccaatcggcgttgaagacagggcgggggcgagcgccctcatcggcagaaaggtggtgtggaggac accgaccggcaggaaaatgttcgggaagattctgagagttcacggtaacagaggggaggtcaaggcatactttaagcccg gccttccaggtcaggccctcggcgattacgtcgaaatcctt TAAATCCCCACATCATTTCTTTTTCCGGTGGGAGAATG GAACTTGTGGAGATCAGGGAAGGACTTGCGAGGGTGTTAGTTCCAAAGGCTGAAAGAATATACGATGCGCCGGTTTTTTA CAATCCTGTGATGGCCCTCAACAGGGATATCAGTGTTCTGGCCGTGAAAGCCCTCTCCCCGAGACGCGTCCTTGATGCCC TCTCCGCAACGGGAATCAGAGGCCTCAGGTACTCCCTTGAAACGTCAGCAGAGGAAGTCTGGATGAACGACATCAATGAA GATGCGTTTCGCCTTATCCTCAAGAACCTTGAGCTGAACTTTGGATCGAAACCGGTGCTCGCGAATGGAAGGGCTGAGCT TGGACTACCTGAAAAGCGTCTCGTTGTAAACCTCGGCGATGCCAATAAGCTCATGTCTGAGAACTTCAGGTACTTTGATT TCATAGACCTTGACCCCTTCGGGTCACCTGTGGAGTTCCTCGATTCAGCCCTTCGATCCGTG