tg1394

Coordinates:1310777-1311355

>tg1394 Metal-dependent phosphoesterase, putative
MLPMLGFLRRRKLRKLRQNSGETLVMHIGDTPERVYPFLKGLIGEARPDVIIHTGDLVDNIKLERRPDLKPAYEAGLRKL
ARILKGSRAKLYIVPGNEDDPELLRRFFGESVVEPGSIVEICRKTFALGHCWRDVADKEADFKLYGHNFKAIPRGLNAVL
GVNFIFLPSGRVVKVDYPVGTDTARGYRLWRGL

>tg1394 Metal-dependent phosphoesterase, putative
gtgctcccgatgctcggcttcctgaggaggagaaagcttagaaagctcagacagaattcaggagaaaccctcgtcatgca
cataggggacacgccagagcgcgtttatccctttctcaaaggtctcatcggagaggctcggccagatgtgataatccaca
cgggcgatttagttgacaacatcaagctggagcggagacctgacctaaagccagcttatgaagcaggcctgagaaagctc
gcgcggattctcaagggctctagagcgaagctttacatagttccaggcaacgaggacgatcccgagcttttgagacggtt
ctttggggaaagtgtcgtcgagcccggaagcatcgtcgagatctgcagaaagaccttcgcgctcggccactgctggcggg
acgttgcagataaggaggcagacttcaagctctacggccataacttcaaagccatccccaggggactgaacgcggttctc
ggcgtcaacttcatcttcctgccgagcggaagggtcgttaaggtggattaccccgtgggaaccgacacggccaggggtta
caggctttggagggggttg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1310277 - 1311855 (Additional range around tg1394 is :500nt.)

>Thermococcus gammatolerans EJ3 TATATTCTTTCAGCCTTTGGAACTAACACCCTCGCAAGTCCTTCCCTGATCTCCACAAGTTCCATTCTCCCACCGGAAAA AGAAATGATGTGGGGATTTAAAGGATTTCGACGTAATCGCCGAGGGCCTGACCTGGAAGGCCGGGCTTAAAGTATGCCTT GACCTCCCCTCTGTTACCGTGAACTCTCAGAATCTTCCCGAACATTTTCCTGCCGGTCGGTGTCCTCCACACCACCTTTC TGCCGATGAGGGCGCTCGCCCCCGCCCTGTCTTCAACGCCGATTGGCTTGAGAATCATGTGGTGGTTGTGTCTGTGCTCG TGGGAACCGGCGTAGGCGAGGATCAGGGCCTTTCGCCTCATGACCCTCACCCCAAGCTGATAGGGAAACGTGGATTTTTA AATGTTATTTCCAGCCCCACCCCAAGATCGACCCGTTCGCTGGATTGCCTGCCGTTAAGAGGAGAAACGGTAATATACAC AAACCAACCAACGTTCATCA gtgctcccgatgctcggcttcctgaggaggagaaagcttagaaagctcagacagaattc aggagaaaccctcgtcatgcacataggggacacgccagagcgcgtttatccctttctcaaaggtctcatcggagaggctc ggccagatgtgataatccacacgggcgatttagttgacaacatcaagctggagcggagacctgacctaaagccagcttat gaagcaggcctgagaaagctcgcgcggattctcaagggctctagagcgaagctttacatagttccaggcaacgaggacga tcccgagcttttgagacggttctttggggaaagtgtcgtcgagcccggaagcatcgtcgagatctgcagaaagaccttcg cgctcggccactgctggcgggacgttgcagataaggaggcagacttcaagctctacggccataacttcaaagccatcccc aggggactgaacgcggttctcggcgtcaacttcatcttcctgccgagcggaagggtcgttaaggtggattaccccgtggg aaccgacacggccaggggttacaggctttggagggggttg TGATGAGACTGCTCCGTTTTGGGCCATCGATTATCTTCC TGAGGACTCCACACAGGGAAGCGGTTGAATCAGCAATCGAGGAGCTTTTCGGCGTTGAAAAGACTCCAACTGACATCGCG ATAAAGGAGAGCAGCGAGTTTGAGACCGTGCTTTTCGTCACGGACGAGTGGAAGAAAGAAACCATTCCCCCCGAGAGTGC GTTCCTCATAAGGTGCCACGCTCCAGCCGTTCTGAGCAGAATCATAAACGCCAACCTGCCAGTCGAGAAGGTTCACGTCG AGAGCGCGATAATATTCCTCAGGGTTCCCGATAGAGTCGGGGAAGGGCTCAAACTGATAGCCGAGAAGTATAACGGAGAG GTTATGGACATAAGGACCGCCCTCGATGAGGGCGAGGCTATGGACACGATAATAGGCCTGACGAGGAAAAAGCTGAACTC GCCAATAGGGCCAGAGGACGTGGAAGGAGCCGTCCTCGTGAGGAGGGACTTCCTGAGCGT