tg1404

Coordinates:1319694-1320476

>tg1404 Inositol-1-monophosphatase (suhB)
MTDPSEVIWNEVVFSLAKDLEKVVMPIFGKPKAGETVGTNVSGDVTKYVDKVAEEMVLERLKILGINVVSEEVGTIDVGS
EYTAVVDPIDGSYNFAAGIPIFAFSFALFRRRKPVYAALYEFTTGNYYEAIPGNGAFMNGRPIKVQQVPASRAAISFYTR
GRGVGLISRVKRVRVLGAIAVELAYLARGTLQGVVDIRNYVRPTDVAAGVMLVREAGGLVVDDSGKDIDVHLSAEEKMNL
IAVSDQELLRIILEEVNGSGS

>tg1404 Inositol-1-monophosphatase (suhB)
atgaccgacccatcggaggtcatatggaacgaggtcgttttttcccttgccaaggatcttgaaaaggtcgtcatgcctat
ctttggaaaacccaaagcgggagaaaccgttggaacgaacgtcagcggagacgttaccaagtacgtggacaaggttgccg
aggaaatggttctggagaggctgaaaatcctcgggataaacgtcgtcagcgaggaagtcggtaccatagacgtcggaagc
gagtacacagcggtagttgatccaatcgatgggtcatacaacttcgccgcgggcataccaatcttcgccttcagtttcgc
actgttccgaaggagaaagcctgtttacgccgccctttacgaattcaccacaggaaactactatgaagcaatccctggga
acggagcatttatgaacggaaggccaattaaggttcagcaggttccagcatcgagggcggcgataagcttctacacccgg
ggaaggggcgtgggacttatcagccgcgttaagagggttagagtcctcggggcgatagcggtagagctggcgtacctcgc
gaggggcacgctccagggcgtggttgacataaggaattacgtacgaccaacggacgtggcggcaggggttatgctagtgc
gtgaagctggtgggctcgtcgtcgatgactccggaaaggatatagacgtgcatctgagcgctgaagagaagatgaacctg
atagcggtgagcgatcaggaactgctcaggataattctcgaagaggtgaacggtagtgggagt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1319194 - 1320976 (Additional range around tg1404 is :500nt.)

>Thermococcus gammatolerans EJ3 AGACACGTTGGAACCGGAGAAAAGTTGTATCCCCTCTACCGTGACGTTGGTTTTCTCCTCGTCGGCGGTCTCCTTTTCAT TCTGATAATAAACCTCGACAAGGTGAACTTTCGGTGGGAGTACTTCAAGTACTTCATTCCGTCCCTCCTCGTTGCCGAGG CCTTCATATGGACCCTCTCCCGGAAGTTCGAGCTCATCAGAAACAACAGGTTGCTTTTCTACACCCACTTCTACGACGCG ACGACGACCTTCGTTGGGATACAGTTCTTCGGTTACTGGGAGCAACACGTTCTCGCAAGAACGCTGATAGACCTGACGGG AACGGCGGCGGTGATGTACCTCGAAAAGCTGATCATCCTGCTCCCAATCGTGTGGATACTCGACGTCGAGATGAAGGATG AAGACCCGGATTTAATAAACTTCGTTAAACTGGCCATGTTCATCCTCGGCTTTGGGCCCGGGACGAGGAACCTACTCATA ACGCTCATGGGGGTGGGAAG atgaccgacccatcggaggtcatatggaacgaggtcgttttttcccttgccaaggatct tgaaaaggtcgtcatgcctatctttggaaaacccaaagcgggagaaaccgttggaacgaacgtcagcggagacgttacca agtacgtggacaaggttgccgaggaaatggttctggagaggctgaaaatcctcgggataaacgtcgtcagcgaggaagtc ggtaccatagacgtcggaagcgagtacacagcggtagttgatccaatcgatgggtcatacaacttcgccgcgggcatacc aatcttcgccttcagtttcgcactgttccgaaggagaaagcctgtttacgccgccctttacgaattcaccacaggaaact actatgaagcaatccctgggaacggagcatttatgaacggaaggccaattaaggttcagcaggttccagcatcgagggcg gcgataagcttctacacccggggaaggggcgtgggacttatcagccgcgttaagagggttagagtcctcggggcgatagc ggtagagctggcgtacctcgcgaggggcacgctccagggcgtggttgacataaggaattacgtacgaccaacggacgtgg cggcaggggttatgctagtgcgtgaagctggtgggctcgtcgtcgatgactccggaaaggatatagacgtgcatctgagc gctgaagagaagatgaacctgatagcggtgagcgatcaggaactgctcaggataattctcgaagaggtgaacggtagtgg gagt TGAGGATCTTGTAAAAGCAGTGAGATACGCGTGGCTCACCTACACCCTCGCCTTCATCAACGTTGCTGTTTACCT CTACGAGCTCCATCTGAGCGACTCGATAGCGGGGCCATCCGTCTACGCTCTCTTAAAGCTCGCGCTCGTGAACGTCCTCG TGACCCAGCACCACGAGTGGTGGAGGCTCTTCACGGCGATGTTCGTGCACCTGAGCTGGATCCACCTGGCGATGAACACC TTCTTCCTCATATATCTGGGAAGCCAGCTGGAGCTCTTCGTGGGCAGGTGGAGGTACCTGATCCTTTACATAACCGCCGG CCTGTTCGGTAACGTCCTCAGCGTAGCCCTTATGGATCCGTACACAATAAGTGGAGGAGCGAGCGGGGCCCTCTTCGGCA TAGCAGGGGCACTGATAATGATAGAGGGCATACTGAAGAAGAACATCCAGAGTGCTCTGGCCAACGCGTTCTTTCTCTTC CTGATAAACAGCTGGATGCCCCAC