tg1407

Coordinates:1321909-1322646

>tg1407 CRISPR-associated protein Cas6
MRIEIRLRPVGDDPILPFNYNYEVYRQIVEKISLISPRLAQEVEVSHVDHFTFSRILVRKRELIPESGIRILSETVSLYV
SSHSPEVIGAIVEGFMASPSIRIGETDFVAEDVKPLKEPRIKDGTLFSTLSPIIVRTVKISNNRMKIWDLYPNEPTFFDK
LRKVMLLRYSELYGSTPEDSAFKIEVIKFKPVRILVADTYYRGSLMIFRYWGSREIAKFGYDLGFGEKTKYGFGMVKVID
EGTEEK

>tg1407 CRISPR-associated protein Cas6
atgagaatcgaaatcaggctcaggcccgttggggatgatccaatcctgcccttcaactacaactacgaggtgtaccgcca
gatcgtggagaagatttcgctgatctccccccggctggctcaggaggtggaggtcagccacgttgatcacttcacgttct
cccgcatactggtgagaaagagagaattaatccccgagagcggcatacggattctatccgagacggtctcactgtacgtt
tcgtcgcattctcccgaggttataggggcgatagttgagggattcatggccagcccctccataaggatcggcgagaccga
cttcgttgctgaagatgttaaacccctcaaggagcccaggataaaagacggaaccctcttctcaacgctaagcccgataa
tagtccgcaccgttaagatctcaaacaacagaatgaaaatatgggacctatatcccaacgagcccacgttctttgataag
ctcaggaaagttatgctcctccgctactccgagctctacgggagcacccccgaggattctgcattcaagatagaggtcat
taagttcaagccagtgaggattctcgtggcggacacatactaccgcggatcgcttatgatattccggtactggggctcga
gggagatagccaaattcggctacgatctgggcttcggggagaagacgaagtacggtttcggcatggtcaaggttattgac
gagggcaccgaggaaaaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1321409 - 1323146 (Additional range around tg1407 is :500nt.)

>Thermococcus gammatolerans EJ3 CAAGGGTGGGCATAGTCTCGGCTTCGCGTGGAAAAGCCCCGAAGTTTGAGATCGAGATGAACTACATCAAGATACCGACC GTGAAGCCAGATGATACCGTCATAGTGGCAGATCCCATGATTGCCACCGGCTCAACGCTTATCCGGGTTCTCAAAGAGGT GTCAAAGTACGGAAGGCCAAAGAGGCTTATCATCCTGGGGGTGCTCGCAGCTCCTGAGGGAATCAGCAGGATCAAGGAGG CCTTTCCCGAGGCGGAAATTTTCGTCGCCAAGGTCGACAGGGAGCTGAACGAGAAGGGCTACATCCTCCCGGGCCTCGGG GACGCCGGGGACAGGGCTTTCGGAGCGCCCCTGAAGAGTCCCCGATAAGTTCGTTCTCCTTATCCTTAAAATTTCAAGAT GACGTTTGGGAGTAGTTTAAATTCGAAGGTGCGTTACGAAAACCTTATTAGCATTGGACTCAAAAATCAACTGTCTACAA CCCAACCCGGAGGGGCTAAA atgagaatcgaaatcaggctcaggcccgttggggatgatccaatcctgcccttcaacta caactacgaggtgtaccgccagatcgtggagaagatttcgctgatctccccccggctggctcaggaggtggaggtcagcc acgttgatcacttcacgttctcccgcatactggtgagaaagagagaattaatccccgagagcggcatacggattctatcc gagacggtctcactgtacgtttcgtcgcattctcccgaggttataggggcgatagttgagggattcatggccagcccctc cataaggatcggcgagaccgacttcgttgctgaagatgttaaacccctcaaggagcccaggataaaagacggaaccctct tctcaacgctaagcccgataatagtccgcaccgttaagatctcaaacaacagaatgaaaatatgggacctatatcccaac gagcccacgttctttgataagctcaggaaagttatgctcctccgctactccgagctctacgggagcacccccgaggattc tgcattcaagatagaggtcattaagttcaagccagtgaggattctcgtggcggacacatactaccgcggatcgcttatga tattccggtactggggctcgagggagatagccaaattcggctacgatctgggcttcggggagaagacgaagtacggtttc ggcatggtcaaggttattgacgagggcaccgaggaaaaa TAGTCCCTCTTCCGAACTTTTTCCGAAGGATAGAGTTAAA AAGGCAGTTCTCGGTATTATAGTCAGGTGAGAGAATGGGAAGTTTCGATGAGGTAAGCCACGATACAGGTTACGAGGATT ACATCACGTTCCTCAAGAGGAGGATAAGGCAGCTTGAACTCCAGGTCAGAACCCTGGAGGCGGACAAGGAGAGACTCGAG CGGGAGCTCTCAAGGCTTAGGACGGAGATGTCCCGGCTCAGGCAGCCCCCGGCCTTCGCTGGCACTGTCATAGAGGTTCT CGATGACGATAGAGCGATAGTCCAGAACTACAACGGGCCGCGCTTCGTCGTCAGGATCGCGCCGTGGATAGAGCGGGACA AACTGAAACCCGGCTCAAGGGTCGCTTTAGACCAGAGGACAATGGCAATAGTCGAGCTCCTGCCAACAGAGAAGGATCCA AGTGTTCTTGGTTTCGAGGTCATAGAGAAACCCAGGGTCACGTATCAGGACATTGGCGG