tg1409

Coordinates:1324048-1324521

>tg1409 hypothetical protein TGAM_1409
MNRISTKEFLQRDSDPDQLARKGGQPLRELQWVLYRKHRQGFQQQDNSDDNSQEGARTTHIKVLVKRKFANGLYIEVMPP
YQGKVEISEAFDQEGVGYLVQVHPEGNSGEGTYGMAFIDLTSEKSIKMKITVEVQYGFRRYRGTFSAVILDPLFKPLA

>tg1409 hypothetical protein TGAM_1409
ttgaaccgcatatccacaaaagagttcctacaacgagacagcgatcccgaccaactggctcgcaaagggggacagcctct
acgcgaacttcagtgggtactttaccgtaagcatcggcagggatttcaacaacaagataattctgatgataactcccagg
aaggtgcgaggacaacccacataaaagtgctcgtaaagaggaagttcgcaaacggactttacattgaggtaatgcctcct
tatcaggggaaagtcgagatcagcgaggccttcgatcaagagggagtgggttacctagttcaggttcatcccgagggaaa
ttctggagagggtacctacgggatggccttcatagacctcacctcagagaagagcatcaagatgaagataaccgtagagg
ttcaatacggtttcagaaggtacagggggacgttttctgccgtgatactggatccactattcaaaccactggcg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1323548 - 1325021 (Additional range around tg1409 is :500nt.)

>Thermococcus gammatolerans EJ3 AAACGTCAAGGTAATAGCCGCCACCAACAGGCCCGACATCCTCGATCCGGCTCTACTGAGACCTGGCCGCTTCGACAGGC TCATCGAGGTTCCGCTCCCGGACTTCCGCGGAAGGCTTGAGATACTCAAGGTTCACACGAGGAAGATGAACCTCAGGAAC GTTGACCTCAGCATCATAGCGGACATAACGGAAGGGGCCAGCGGTGCGGATCTAAAGGCAATAGCAACGGAGGCCGGTAT GTTCGCGATAAGGGACAGAAGAACGTACGTAACTCAGGAGGACTTCCTCAAGGCTGTGGACAAGGTTCTGGGAGCGGAGA AGAGGCTCGCCCAGGCGATAGCGATGCACGAGGTTATGTACGGGTGAGATAGCTTTTTAAGTTCCTTTTTAGTATTTATT TAGGTGACCATTGTGAAGAAGCATTTTACGTATGCAGTAGTGGTTGGTTTGATAGGGGCTGTGATTTTTCTTCTGTGGAA CAACGTACTCACAACCACCG ttgaaccgcatatccacaaaagagttcctacaacgagacagcgatcccgaccaactggc tcgcaaagggggacagcctctacgcgaacttcagtgggtactttaccgtaagcatcggcagggatttcaacaacaagata attctgatgataactcccaggaaggtgcgaggacaacccacataaaagtgctcgtaaagaggaagttcgcaaacggactt tacattgaggtaatgcctccttatcaggggaaagtcgagatcagcgaggccttcgatcaagagggagtgggttacctagt tcaggttcatcccgagggaaattctggagagggtacctacgggatggccttcatagacctcacctcagagaagagcatca agatgaagataaccgtagaggttcaatacggtttcagaaggtacagggggacgttttctgccgtgatactggatccacta ttcaaaccactggcg TGAGTTTATACGATTTCAGTGGACAGAGATGGCCGACTAAGGTTTATAAAATCGGAGCGTAAGT AACGCTAGGAGGGAGGAGATGGTCAGCAAACTTCTGGCCCTCGAAGCGTACCCAAGCCTCCGCGACCTGGACTTCAGAAT CCTCAGGGGAGTAGAGCTAAACATGAGGCACCACAAGTGGGTGCCGTTGGAGGACATCGCGCGTTTCGCGAGGGTAGATG TTGAAACGGCCTCTTTCAGGCTCGGCAAGCTCGACGATATGTCACTCGTCAGGCGGAGGAGCGACATAGGCTACATCGGC TACCAGCTCACGATACACGGCTACGACGTTTTGGCCATAAGGGCCCTCGCGAGGAAAGGGGTTGTAGAGGCAATAAGCAC GACGCAGATCGGAGTTGGCAAGGACGCCGACGTTTACGTCGGGATAACGCCAACCGGCGAGAAAGTTGCCGTTAAGTTCA ACAGGATAGGCGGAAGAACCGCATCGAGGAGGGCA