tg1412

Coordinates:1325998-1326927

>tg1412 Biotin synthase related protein
MLVRVSYGTAIAMGLIRAKLLARPTTAYLMTYWPGKCANDCAFCAQARSSKADLAKLSRVTWPAFELEKVVQALPNGRFG
RICLQTIDYPGMLDDVLALLRALKPLSLPVSVSITPVDNATLEEFKGLGVDYVGVGLDVASERLFGEIKPDFEWDEMWGF
AERIVEVLGPGKALIHVIVGLGETDRELVEVFERAYSIGADVSLFAFTPLKGTRLENLEPPSVERYRKVQLARWLIERDL
GDRILFEGESIAGFDLEDIEVPPAVFATHGCPACNRPYYNERPGGELYNFPFPPEERYVKKIISALQGER

>tg1412 Biotin synthase related protein
atgctcgttagggtctcctacggaacggcgatagcgatgggcctaatcagggcaaagctcctcgccaggccgacgaccgc
ctatctgatgacctactggcccggcaagtgcgcgaacgactgcgccttctgcgcccaggcgcgctccagtaaagcggacc
ttgccaaactctcccgggttacgtggcctgccttcgagctcgaaaaagtcgttcaagctctccccaacggccgtttcgga
aggatatgcctccagacgatagactatcctgggatgctcgacgacgttctggcacttctgagggcgctcaagcccctcag
cttgccggtctcggtctcgataacgcctgttgataatgccacgcttgaggaatttaaagggctcggcgttgactacgttg
gggtgggtctcgacgttgcaagcgagaggctcttcggtgaaataaaaccagactttgagtgggatgagatgtggggcttt
gcggagaggatagttgaagtcctcggtccggggaaagctttaatccacgtcatagtcggcctcggcgaaaccgacaggga
gctcgttgaggttttcgagagggcctactcaattggagcggacgtctcgctcttcgcattcacccctctgaaggggacga
ggcttgagaacctcgaaccaccgagcgttgagcgttaccgtaaagtccagctggcgaggtggttaatcgaacgtgatctg
ggtgataggatactgttcgagggggagtccatagcgggcttcgatttggaagacattgaggttccgccggcagttttcgc
gacgcacggctgtcccgcctgcaacaggccctattacaacgagaggcccgggggagagctctacaacttcccgtttccgc
cggaagagcggtacgttaagaaaatcatttcagcccttcaaggagagaga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1325498 - 1327427 (Additional range around tg1412 is :500nt.)

>Thermococcus gammatolerans EJ3 AGCTACGCGGGTGTTATAACTTACCTCCCTGCCCTTTACAAGTCCCTTTCCCTCCCCCAGAGCCTCTTCGGTTACTATAT GATGGTCATCGGCATCTTCTCCTTTATGACGCGCCTTATCGGGGGCAGGAGCGCTGACAGGCACGGGCCTCTCCCCGTGA TAACCTTCGGCCTCTCCCTGCTCCTCCTCGGCTACGTCCTGCTTAACCTTTACACCCTTCCGCCTCGCTCCTACGTAAGT GCTTCCCTAGTCGGGGCCGGTTTTGGCTTAGCGGTCCCGGCGATGCAGCTGATGGCCCTCGGAAACCTTCCGAGGAGAAT CAGGACGATGGGTTCTGGAATCTACACGATGTTCTTTGACCTCGGAATGCTTGCGGGTCAGGTCAGCCTTGGCTACGTTG CCCAGCTCAGGGGTTACACCGGCGTCTTCCCGCTCCTCCCGCTCATCCTGGGGGTCGGGTTTATAACCCTCTACGCGCCC ATCATCTGGGGGAAGTTAA atgctcgttagggtctcctacggaacggcgatagcgatgggcctaatcagggcaaagctc ctcgccaggccgacgaccgcctatctgatgacctactggcccggcaagtgcgcgaacgactgcgccttctgcgcccaggc gcgctccagtaaagcggaccttgccaaactctcccgggttacgtggcctgccttcgagctcgaaaaagtcgttcaagctc tccccaacggccgtttcggaaggatatgcctccagacgatagactatcctgggatgctcgacgacgttctggcacttctg agggcgctcaagcccctcagcttgccggtctcggtctcgataacgcctgttgataatgccacgcttgaggaatttaaagg gctcggcgttgactacgttggggtgggtctcgacgttgcaagcgagaggctcttcggtgaaataaaaccagactttgagt gggatgagatgtggggctttgcggagaggatagttgaagtcctcggtccggggaaagctttaatccacgtcatagtcggc ctcggcgaaaccgacagggagctcgttgaggttttcgagagggcctactcaattggagcggacgtctcgctcttcgcatt cacccctctgaaggggacgaggcttgagaacctcgaaccaccgagcgttgagcgttaccgtaaagtccagctggcgaggt ggttaatcgaacgtgatctgggtgataggatactgttcgagggggagtccatagcgggcttcgatttggaagacattgag gttccgccggcagttttcgcgacgcacggctgtcccgcctgcaacaggccctattacaacgagaggcccgggggagagct ctacaacttcccgtttccgccggaagagcggtacgttaagaaaatcatttcagcccttcaaggagagaga TGACCTCCT CCATTTCCCTCACGGAAAACTTTTCTTCAACCTTCTTTCCTTGAATCACGTTCAGGATCGCTCTTACAAACGCCTTAAGC TCTTCGTCTTCATCGGCTTGTCTTATGAAGCTTTCGGGATCGTTCTCAAGCTCCCCCAGCTTTCCTGCTTCCTTTATGAC GGCCAGGATATCACCGAGCCTTTTCACGCCGAGCCGGTATAGATTTTCGTTGGGGGCCCTCACCGTTCCCCGTATCGCGC ACTTCACCGCTCCTCTGTAGTTGTCCTCCTGGAGGAATATGTCGGCCAGGCGGAAGCAGGCCTCGAAGTAGAACTCAGGC TCTACGTCGAGGCTCTCGTGAAGTATCTCGTCGAGCTTCCTCTTCGCGGTTTCAAAGTCGTTCCTGTTCTCGGCCTCGAT TGCCTCGCGGAAGAGCTTGACAATCCTCTCGCGCCTGTTAAGGGGCTCGTACTTAATTGCCATATCCTTCACCCCTGCTC TCGTGCCAGGC