tg1421

Coordinates:1334767-1335453

>tg1421 Hydrolase, putative
MDTVTVLTMVVYLFDFDGTLVDSHQAVEKALRLAIERTMPAVIESDLYDEYYTALFLFIKGKLTYRHLGVIHELVAQGTI
HEYYRLMPRFIQDLPHARRVIRTLRKAGRTVISFSGEHTYPGGKVIFLKKTNWYDEFDMVITFRSTRDMLQKFQAVRELY
PEDPIVWVDDSPGRFTYITDENTLLVQKASPYKHDVALLFERENFIKIKSLREILDIDERLTEFFEGGD

>tg1421 Hydrolase, putative
atggatacagttacagtgttgaccatggtggtgtacctcttcgactttgatgggacgctcgtggacagccatcaggccgt
tgagaaggctctgagactagcgatagagcgcaccatgccagccgttattgaaagtgacctctacgacgagtattacacgg
cgctcttcctcttcatcaaggggaaacttacctacaggcacctcggcgtcattcacgagctcgtggcccagggcacgata
cacgagtattatcggttgatgccgcgcttcattcaggatctgccacacgcgaggcgggtcattagaaccctcaggaaggc
ggggaggacggttataagcttctccggtgagcacacttatccaggaggaaaggtcatatttctcaagaagacgaactggt
acgatgagtttgacatggtcataaccttcaggagcacaagggacatgcttcagaagtttcaggcagttagggagctctat
ccagaggatccaatagtttgggtcgacgacagcccgggacggttcacctacataaccgatgagaacacccttcttgtgca
gaaggcctcgccctacaagcacgacgtcgcgctcctctttgagcgtgagaatttcatcaagataaagagcctcagagaga
tcctcgatattgatgaaagacttacggagttctttgaggggggagat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1334267 - 1335953 (Additional range around tg1421 is :500nt.)

>Thermococcus gammatolerans EJ3 TCGGAATCAGAACAGCATCTCGCCGCCCGTGAGGAAGTCCTGGCTTATCTTGCCCTTTCTGAGGAGCCAATCAACCTGAG TCCTCGTGTAGCGGTAGACTATGTCACCCCTCTTATCGGTCTGAACCGGCCAGGGCTGGACTATTACCACGTCGCCAACG CGCATCCACATCCTCCTCTTTAGCTTGCCAGGGATCCTGCATCTCCTGACCTTTCCGTCCTCGCAGCGGACGTCCATCCA GCCCGCTCCGAGGGCCTGCTCTATAACACCGAAGAGCTGTCCCTTACTCCTGTCCGGGAGGGGAACGCGAATTATCTCCT CTCCTTCCTGATGGTTTTTCTTACCCTTGCCTCTACTACCCCTGTGGTAAGCCATGATCATCACCTCCACACACTCGGTT TGAGTCCTTATAAACCTGAGCCTTGCAAAAATTTTCCATCCAGTGTACACTCTTGCGCTTTTAAAATTTTTGCACGGGCA AACCGTTATATTCCCGGTT atggatacagttacagtgttgaccatggtggtgtacctcttcgactttgatgggacgctc gtggacagccatcaggccgttgagaaggctctgagactagcgatagagcgcaccatgccagccgttattgaaagtgacct ctacgacgagtattacacggcgctcttcctcttcatcaaggggaaacttacctacaggcacctcggcgtcattcacgagc tcgtggcccagggcacgatacacgagtattatcggttgatgccgcgcttcattcaggatctgccacacgcgaggcgggtc attagaaccctcaggaaggcggggaggacggttataagcttctccggtgagcacacttatccaggaggaaaggtcatatt tctcaagaagacgaactggtacgatgagtttgacatggtcataaccttcaggagcacaagggacatgcttcagaagtttc aggcagttagggagctctatccagaggatccaatagtttgggtcgacgacagcccgggacggttcacctacataaccgat gagaacacccttcttgtgcagaaggcctcgccctacaagcacgacgtcgcgctcctctttgagcgtgagaatttcatcaa gataaagagcctcagagagatcctcgatattgatgaaagacttacggagttctttgaggggggagat TGAAGTGAAGGT TCTTGTTCTCGGCGCTGGAAACGTTGGAAGGGCCATAGCGTGGGATTTGAGGGACGAGTTCGACGTCCACGTCGCAGACC TAAGCGATGACCGATTAAGGGCCGTCTCCGGGTTCGCCACACCGTTCAAGCTCGATGCCTCTCGCTTCGACAAGCTCGTA GAGGCAATGAAAGGATTCGAGCTCGTTATCGGCGCACTGCCCGGTCGCTTCGGCTACTCCTCAATCAAAGCCGCGATAAA GGCCGGCGTTGACATGGTGGACGTCTCTTTTACGCCCGAGAACCCGCTCGAACTTCGGGAGGAGGCAGAGAACGCCCAGG TTACGGTGATATTCGATGCGGGCTTTGCCCCCGGGCTGAGCCACATCCTGATGGGCAGAATCTGGAACGAGCTCGACGAC ATGAGCGAGGGCTACATCTACGTCGGCGGCCTGCCTAAGGAGCCGAGACCACCACTTTATTACAGAATTACGTGGTCACC TAAAGATT