tg1423

Coordinates:1335963-1336736

>tg1423 Protein serine/threonine kinase, RIO1 family (rio1)
MREEAIEREIEEILGLRERREKDSELYKIANEVFDRTTKETLAYLHRRGKIEELYGVVSTGKEANVFAGVDAEGNKIAVK
IYRTYTTEFRRIWEYLAADPRIGYLPKDMRKLVFVWTRREFKNLQRAIKYAVRVPEPVIFRNNVLVMEFIGDETPAPRLK
DVEKSLERSDFEELYSYLMSVIERLWKRGDMVHGDLSEYNVLLWDGPVVIDWSQATVRRNRMSVELLKRDLRNVTNYFAR
KGVDVEDYEVKLRELIER

>tg1423 Protein serine/threonine kinase, RIO1 family (rio1)
atgcgcgaggaagccatcgaacgggagatcgaggagatactcggcctcagggaaagaagggagaaggacagcgagctcta
caagatagccaacgaggtcttcgacagaacaacaaaggagacgctcgcttacctccacaggcgcggtaaaatagaggagc
tctacggcgtcgtaagcactggcaaggaagcaaacgtcttcgctggcgtagatgctgagggcaataagatagcggtgaag
atttacagaacctacacaaccgagttcagacggatatgggagtacctcgccgccgacccgcgcatcggctacctgccgaa
ggacatgcggaagctcgtcttcgtctggacgaggcgggagttcaagaacctccagagggcgataaagtacgcggttcgcg
ttccggagcctgtaatcttccgcaacaacgtccttgttatggaattcatcggcgatgaaaccccagctccccgtcttaag
gacgttgagaaaagcctcgaaaggagcgacttcgaggagctttacagctacctgatgagtgttattgagaggctctggaa
gcgcggtgacatggttcacggtgatttgagcgagtacaacgtcctgctctgggacgggcctgtggttatagactggtcgc
aggctaccgtgaggaggaacaggatgagcgttgagctgttaaagcgcgacttaaggaacgttaccaactacttcgcgaga
aagggtgttgatgttgaggactacgaggtgaaactccgcgagctgattgagagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1335463 - 1337236 (Additional range around tg1423 is :500nt.)

>Thermococcus gammatolerans EJ3 TATAACGGTTTGCCCGTGCAAAAATTTTAAAAGCGCAAGAGTGTACACTGGATGGAAAATTTTTGCAAGGCTCAGGTTTA TAAGGACTCAAACCGAGTGTGTGGAGGTGATGATCATGGCTTACCACAGGGGTAGTAGAGGCAAGGGTAAGAAAAACCAT CAGGAAGGAGAGGAGATAATTCGCGTTCCCCTCCCGGACAGGAGTAAGGGACAGCTCTTCGGTGTTATAGAGCAGGCCCT CGGAGCGGGCTGGATGGACGTCCGCTGCGAGGACGGAAAGGTCAGGAGATGCAGGATCCCTGGCAAGCTAAAGAGGAGGA TGTGGATGCGCGTTGGCGACGTGGTAATAGTCCAGCCCTGGCCGGTTCAGACCGATAAGAGGGGTGACATAGTCTACCGC TACACGAGGACTCAGGTTGATTGGCTCCTCAGAAAGGGCAAGATAAGCCAGGACTTCCTCACGGGCGGCGAGATGCTGTT CTGATTCCGAGTGATGGGAG atgcgcgaggaagccatcgaacgggagatcgaggagatactcggcctcagggaaagaag ggagaaggacagcgagctctacaagatagccaacgaggtcttcgacagaacaacaaaggagacgctcgcttacctccaca ggcgcggtaaaatagaggagctctacggcgtcgtaagcactggcaaggaagcaaacgtcttcgctggcgtagatgctgag ggcaataagatagcggtgaagatttacagaacctacacaaccgagttcagacggatatgggagtacctcgccgccgaccc gcgcatcggctacctgccgaaggacatgcggaagctcgtcttcgtctggacgaggcgggagttcaagaacctccagaggg cgataaagtacgcggttcgcgttccggagcctgtaatcttccgcaacaacgtccttgttatggaattcatcggcgatgaa accccagctccccgtcttaaggacgttgagaaaagcctcgaaaggagcgacttcgaggagctttacagctacctgatgag tgttattgagaggctctggaagcgcggtgacatggttcacggtgatttgagcgagtacaacgtcctgctctgggacgggc ctgtggttatagactggtcgcaggctaccgtgaggaggaacaggatgagcgttgagctgttaaagcgcgacttaaggaac gttaccaactacttcgcgagaaagggtgttgatgttgaggactacgaggtgaaactccgcgagctgattgagagg TGAG AGCATGGACGAGTTTGAGAGGCTCCTGAAGAAGTACGAGCGCGTTGATAAGGACGGAAGGCCAATTGGGGAACCTAAAGA GGAGGAAATTGATTACCTCGCTGAGGGCGAGCAGGAGGAGTTCGTAAGGATTCCCAAGGAAAGGATAGCGGTTCTCATCG GTAAGAAAGGCAGAACCAAGAGGGAGATAGAGGAGCGTACAGGCACGAAGATAGAGGTTGACAGCGAGACGGGAGAAGTT TTCATCACCGCCACGAAGAAGACGAAAGATCCCCTCGCCGTCTGGAAGGCAAGGGACGTCGTCCTCGCCATCGGGAGGGG CTTCTCCCCCGAGAGGGCCTTCCGCCTGTTTAACGAGGGTGAGACCCTCGAGATCGTGAACTTAACAGACATCGTCGTTG GAAACGAGAAGAACGCCCTTCCGAGGGTCAGGGGTAGGATCATCGGGCGGAGGGGGAGGACGAGGGAGATTATCGAGGAG ATGAGCGGTGCCGAC