tg1432

Coordinates:1343560-1344123

>tg1432 GTP-binding protein
MIKVAIIGAENVGKSTLMNALLGGKVSEVEDLPGTTKGIIRKRFGKLKIPKGMKNPFGGADEFVLIDTAGLFDPRLELRG
KVLSEERFRELMEEIVSADIIIHMVDATVGLHRGMEKLHHMLKMRYEKPIIVVINKIDLVSRERVEELRKIIKKRLEQEP
LALSLVTYEGFNELLERIAHMAMYAGRH

>tg1432 GTP-binding protein
ttgataaaggttgcgataatcggtgccgaaaacgttggaaaatcgacccttatgaacgcccttctcggcggaaaggtcag
cgaagtggaagatctgccgggaacgaccaaggggataatccggaaacgctttggaaagctgaagatacccaagggaatga
agaacccgttcggtggggctgacgagttcgtgctcatagacacagcggggttattcgatccccgcctcgaactgcgcggg
aaggttctcagcgaggagcgctttagggagctcatggaggaaatagtctcagcggacataataatccacatggttgacgc
gacggttggccttcacagggggatggagaaactccaccacatgcttaagatgcgctatgagaagcctataatcgtggtga
tcaacaagatcgatctagtttcgcgcgagagagtcgaggagctaagaaaaatcataaagaagaggctggagcaggagcca
cttgctctttcgctcgtcacctacgagggcttcaacgagctcctagagaggatcgcccacatggccatgtacgccgggag
gcat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1343060 - 1344623 (Additional range around tg1432 is :500nt.)

>Thermococcus gammatolerans EJ3 CTGTAGGAGTGGGCCGCTATGGGCTCGGGATTGGGAATCCCCCGCAAAAGCCATCCCGTTCTCGGGAGCCTCTTCAGGTT TCCGAGCTCCAAGAACAGCTCCAGCATGCTCACTCCTCCGTTGTGAAGATAGCCCGCTCCGTTTCCACCGCGGTGGCCAT TATCCCGTCTCCGAGGAACCGCCCGTACACCTTAACCCTCTCTCCGACCCCTATGCAGGGGCTTCCCGAGAACTCGACCC TGATTCCGTCGAGCAGGAAGGTCGTCCTGTAGCTGGGAAGTTCCATTGGAAGAAACTCAACGCAGGGCTTGTTCACTATG ACGCCCTCAACGACGACGTTTTTGCCTTTGAACGCCCCGGATTTCAGGTCCTCAGGAGTGACGATGTAGTAATAGTGATG CCCCATCTTGACCCTCTTCGCCATCCCCACCCCTCCGGCAGTTATATAACCGTTAGGATAATCTTCGATAGGTGCGATAA ACCTTGCGGGGGTGAGAGG ttgataaaggttgcgataatcggtgccgaaaacgttggaaaatcgacccttatgaacgcc cttctcggcggaaaggtcagcgaagtggaagatctgccgggaacgaccaaggggataatccggaaacgctttggaaagct gaagatacccaagggaatgaagaacccgttcggtggggctgacgagttcgtgctcatagacacagcggggttattcgatc cccgcctcgaactgcgcgggaaggttctcagcgaggagcgctttagggagctcatggaggaaatagtctcagcggacata ataatccacatggttgacgcgacggttggccttcacagggggatggagaaactccaccacatgcttaagatgcgctatga gaagcctataatcgtggtgatcaacaagatcgatctagtttcgcgcgagagagtcgaggagctaagaaaaatcataaaga agaggctggagcaggagccacttgctctttcgctcgtcacctacgagggcttcaacgagctcctagagaggatcgcccac atggccatgtacgccgggaggcat TAGCTCCACGTCTCGGCTATTACGTCGTGCTTGTGAATGCTCTCGTTGCTTATGA CCCTCACGTGTATTTTCCCCTTGAACCGCTCCCTCGCCTTTGAGAATATCTCCCTCGCAACGTCCTCGACGAACTTCGGA TTCTCGAACATCCTCCTGACCACCGCGTTCTCGTCAACGGTCTTCAGGAGGGTGTACGTCGGTGAGCTGAAGGAGCTCTC AACGACCTCTATCATGTCCTCCAGAGCCACGTTCTCCTCAAAGGCAGTTCTAACCTCGAGCTCCGCAACGGCCCTCTGGA TGTGCGTTTTTCCCTCGTTGTTCGCCATCGCGTGGGGGCAAACCGTGTTTCCGATGACCTTGACCCTGAGGACTTTCTCA AGGCTTTTGTTCTCTTTTATGACGCCGACCTCGACGTCGTAGGGCTCGTAGCTCACTTTTCCGCTCGCAGGGGTCTCACG GGGGATGATGAGATGTGTCCGTATCCACACCTCAGCTCTTCGATG