tg1433

Coordinates:1344516-1345136

>tg1433 Metal-dependent phosphohydrolase, HD superfamily
MLELFLELGNLKRLPRTGWLLRGIPNPEPIAAHSYRVATITLFLADELKSRGVEIDVEKALKIALLHDAGEARITDVPLP
AQRYFNKVEGEVKALGEMLSITGREGEYLSLFREYEEELSVEGKLVKFADRLEMLIQAYEYEKAGFANLDEFWRTVEKLR
ESELYEYFRDIVEGLVERRKKLHRGLAHSHYNNPQLPVEKSSKSQMR

>tg1433 Metal-dependent phosphohydrolase, HD superfamily
atgctggagctgttcttggagctcggaaacctgaagaggctcccgagaacgggatggcttttgcgggggattcccaatcc
cgagcccatagcggcccactcctacagggttgccacgataaccctttttctggccgatgagctcaaatcaaggggcgttg
agatcgacgttgagaaggcactcaagatagcactccttcacgacgctggggaggcaaggataacggacgttcccctgccg
gcccagaggtacttcaacaaggtcgagggcgaggtcaaggcgctgggggagatgctgagcattacgggcagggaggggga
gtacctaagcctgttccgcgagtacgaggaggagctgagtgtagaaggaaagctcgttaagttcgccgacaggctggaga
tgctgattcaggcttatgagtacgagaaagcgggctttgccaacctcgacgagttctggaggacggtggagaagctccgt
gagagcgagctctatgaatactttagggacatcgttgaggggctcgtggagcggaggaaaaagttgcatcgggggttagc
tcactcccactacaacaaccctcaacttccagtggagaagtcctccaagtcccagatgaga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1344016 - 1345636 (Additional range around tg1433 is :500nt.)

>Thermococcus gammatolerans EJ3 GGTCGTTCCCGGCAGATCTTCCACTTCGCTGACCTTTCCGCCGAGAAGGGCGTTCATAAGGGTCGATTTTCCAACGTTTT CGGCACCGATTATCGCAACCTTTATCAACCTCTCACCCCCGCAAGGTTTATCGCACCTATCGAAGATTATCCTAACGGTT ATATAACTGCCGGAGGGGTGGGGATGGCGAAGAGGGTCAAGATGGGGCATCACTATTACTACATCGTCACTCCTGAGGAC CTGAAATCCGGGGCGTTCAAAGGCAAAAACGTCGTCGTTGAGGGCGTCATAGTGAACAAGCCCTGCGTTGAGTTTCTTCC AATGGAACTTCCCAGCTACAGGACGACCTTCCTGCTCGACGGAATCAGGGTCGAGTTCTCGGGAAGCCCCTGCATAGGGG TCGGAGAGAGGGTTAAGGTGTACGGGCGGTTCCTCGGAGACGGGATAATGGCCACCGCGGTGGAAACGGAGCGGGCTATC TTCACAACGGAGGAGTGAGC atgctggagctgttcttggagctcggaaacctgaagaggctcccgagaacgggatggct tttgcgggggattcccaatcccgagcccatagcggcccactcctacagggttgccacgataaccctttttctggccgatg agctcaaatcaaggggcgttgagatcgacgttgagaaggcactcaagatagcactccttcacgacgctggggaggcaagg ataacggacgttcccctgccggcccagaggtacttcaacaaggtcgagggcgaggtcaaggcgctgggggagatgctgag cattacgggcagggagggggagtacctaagcctgttccgcgagtacgaggaggagctgagtgtagaaggaaagctcgtta agttcgccgacaggctggagatgctgattcaggcttatgagtacgagaaagcgggctttgccaacctcgacgagttctgg aggacggtggagaagctccgtgagagcgagctctatgaatactttagggacatcgttgaggggctcgtggagcggaggaa aaagttgcatcgggggttagctcactcccactacaacaaccctcaacttccagtggagaagtcctccaagtcccagatga ga TAACTTCCGGCCCTCAGTTTTTCTTTCTCCCCAATTCTCTTAGCAATCAATCCATAACTCTTTTCCCAGCCCTCAAG ACTCACAAGCTCGGCCTTTCTCTTCAAGTCCTCCAAGATACCTCTTGCCTCCCTCTCGCTCAAATCCTTCCACTTAACCT CAACGAAGAGCGCTCGTTTTTCCCGCTCGTTCAAAGCGACCAAATCAATCTCCTCACCCTTCCGCCACCACCTGCCAATT TTTGTAAAGCGGAACGGCAGTTTTTCAGCCCTGTTCATCCCGATTAAAAATTCCTTAGCAATCTTCTCAAAAACCCAGCC GAGGTAGCGGTTGAAGTTCCTCTCAAAGTGCCCAAGAGCCTCATCGGGAAGCCCAATCTCTATCTCCTCCTTGAACGGGT AAACGAACGTGTAGTAGAAGGCGAAGTAGTTGTCCCGTATGAAATACCGCGAGTTCCTTGCCCGTTTCTTCGGCTTTTCC GTAACGGGAGCTTCCCTGCCAA