tg1441

Coordinates:1351918-1352136

>tg1441 hypothetical protein TGAM_1441
MMSMFMAEFKLKFGDRKWYVRRIVEASSLEEAEEKARKYVQLMNRGEVLWELSYVIEAQRPLIIGDEELKKLS

>tg1441 hypothetical protein TGAM_1441
gtgatgtccatgttcatggccgagttcaagctcaagtttggagacagaaagtggtacgtcaggagaatcgttgaggcttc
ctcacttgaggaggctgaggagaaggccagaaaatacgtccagctcatgaacaggggagaagtgctctgggagctgagct
acgtgatagaggctcagagacccctcataataggcgacgaggagctcaaaaagctgagc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1351418 - 1352636 (Additional range around tg1441 is :500nt.)

>Thermococcus gammatolerans EJ3 TCCAGCGGTTGCCCTCGTCATCACCGCAGCCGTTCCTATCTCCTCGTAACTCATCAGCCGGAAGATCTCACCGAAACCCG TGAGCTCCTTATCGAAGAGGGGTCTGACGCTTTCGATGGTGATGTCCCTGCTAGTTATTCCCGTTCCCCCAGAGGTAACG ACAACATCCGCCCCTGCCTCAAAGGCCTCAACAATGGCGCCGATTATCGCAATCTTCTCGTCCGGAACGATCCGGTAGAG AACACACTCATGGCCGTTCTTCTGAAGTTCATCGACGAGGAACTTCCCGCTTTTGTCTTCTTTTTCTCCCCTGCTCGCGG TGTCGCTGACTGTTATGACCGCGAACTTAAACTTCTTTGGTGCACTCCTCCGGTGCTCTTCAACGCCCATGATACCACCG CATGATGTGGGTGTCAATGGTTAATAACGTTTACCTTGTTAAAGAGCACCGTTTAACACGCGATGCGAGATTTTTTAACC CATTAAACGAAGATCGAACG gtgatgtccatgttcatggccgagttcaagctcaagtttggagacagaaagtggtacgt caggagaatcgttgaggcttcctcacttgaggaggctgaggagaaggccagaaaatacgtccagctcatgaacaggggag aagtgctctgggagctgagctacgtgatagaggctcagagacccctcataataggcgacgaggagctcaaaaagctgagc TGAGCTCCCCGGCGAGGTTTTTCTCCATTATCCTTCTTACTTCTTCAAGACCGTTAGTTCTGCCGAGGGCGTACATAAG CTTGACGAGCGTCGCCTCCTTCGTCATGTCTCCAGCTGGAATAACACCGGCCTCGAGGGCCCTTCTTCCCACCTCGTAGC GCCTCAAGTCAACACCGCCGTAGAGGGCCTGCGTCGTCATGACAACGGGCTTTTCACGGGCGACCCTCGAGACGGCCTCG AGGAGGTTCCGCCCGCGGTAGGGGATTCCTCCGGCCCCGTAACCTTCGAGCACTATCCCGTGAACCTTTTCAGCAACCGC GAGAAAGACCTCCGGCGAAAGGCCTGGCGTCAGGCGAAGGTAGGCAACGTTCGGGTCTATCCTCGGGTCAAAGGACGGCT CTCCAGTAGGAAGCTCGGGCCTGTGCCGTATAACGACCTCCTCGCCCTTGATGTAGGCAATATCAGGATAGTTTATGCTC TGGAAGGCGTTGAGGCCGAG