tg1444

Coordinates:1354397-1354693

>tg1444 Transcription regulator, PadR-like family
MIRRVLLGFMGIHVLHHASREGVTGKFMMDELRKHGYNVSPGTIYPLLHRMEEMGLLKSRTEVRNGKRVRVYTTTPKGEK
LLEEARNKIRELCKELLGD

>tg1444 Transcription regulator, PadR-like family
atgattcggcgcgtgctcttgggcttcatggggattcacgtgcttcaccacgcaagcagggagggagtgacggggaagtt
catgatggacgaactcagaaaacacggctacaacgtcagtcccggaacgatataccccctcctccacagaatggaggaga
tgggccttctgaaaagcagaacggaagttaggaacggaaaacgcgtgcgggtgtacacaacgacccccaaaggtgaaaaa
cttcttgaggaagccaggaacaagattagagagctttgcaaggagctcctaggtgat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1353897 - 1355193 (Additional range around tg1444 is :500nt.)

>Thermococcus gammatolerans EJ3 TTATCATCGCGCTTGCGACGGTATAGACGCTCAGCGTGTTGGTTAAAGCTATCGGCGTCTCGATGTAGCCGAGCTCGTTG ACTTGAACGAAGCCTATCGGCTTGGAGAAGCCGTTCATGACGAAGGTTGAAGCAAAGAGCCTCTCCCTGTATGGGTTCTT AACCGGCGGAAGGAGAACTGTCACGCCTGTTCTTACGTCACTGCCCTCGATGAGCGTTGTGTGGCCGACCTTAACTCCCA AATCAGCTATCGAGTTCCTCTTTCCGTGCTCGTGAACGCCGATTTTTATTCCCAGCTCGGGGGCCTTCATTCCAATCCCC ACCTTAACCTACGGGGAGGATGGTTTTTAAAGGCTGAGGGGTAATGGGATGGGGCGATGACGAATAGCAAGCATTCTGAG AAATGATGAAGTGAACACCCTCCGAGCCCCTTCTGAACTTCCGGTTTTGACGGTCAGGTTTTTAAGCTTAGATATCGTAT TCCGATATCGGTGTCCGAT atgattcggcgcgtgctcttgggcttcatggggattcacgtgcttcaccacgcaagcagg gagggagtgacggggaagttcatgatggacgaactcagaaaacacggctacaacgtcagtcccggaacgatataccccct cctccacagaatggaggagatgggccttctgaaaagcagaacggaagttaggaacggaaaacgcgtgcgggtgtacacaa cgacccccaaaggtgaaaaacttcttgaggaagccaggaacaagattagagagctttgcaaggagctcctaggtgat TG AAATGACCGAAGATGGATCAAAAACCGAAAAGAAAGTCTTCGGAATAAGCTGGAACGTCTTCGTCCTCGGATTGGTCAGC TTCCTCAACGACATGAGCAGCGAGATGATAAACCCAGTAATCCCGAAATACCTCACGGACGTCCTTGGAACCGGTGAGCT CCTGAGCGGGACCCTGATGGGTGCCATAGAGAGCCTCAGTTCACTCTTCAAGGTGGCCTTTGGCTACTTCAGCGACCGGT TTAAAAAGAGGAAGGCCTTCATCTTCGCTGGCTACGCCCTCTCGACCTTTGCTAAGGGTGCCCTCGCGTTTACAAGGCAC TGGTGGGACTTCCTGAGTCTAAGGGTTCTCGACCGCGTTGGAAAGGGCATCAGGACGGCCCCGAGGGACGCCCTCATAGC GGAGTCCTCCGAAAAGGGGAAGACAGGGAAGTCGTTCGGCTTCCACAGGATGATGGACACCCTCGGGGCAGTTGCGGGGC CTCTGGTCGGCATAGGAC