tg1461

Coordinates:1372121-1372663

>tg1461 hypothetical protein TGAM_1461
MSGRVKTAMMSESNADGMMSPEPEREVVELEKLRKSVEELTKHIENLEEQKKPDSLGWDDIAQEIVGAITFALPFIFTEE
LWDIAKDISVGRSIAILIMTLGVAYLFIAKSRIGNLKREELFHVPKRLLTVTLIAYLTSAVLIYLYGINNLADFTAIQYI
NATILVSTFAVIGAITVDMVR

>tg1461 hypothetical protein TGAM_1461
gtgtcgggaagagtgaaaaccgcgatgatgagtgaatccaatgctgatgggatgatgagccccgaacctgagcgcgaggt
ggttgaactggaaaaactccggaagagtgttgaagagctcacgaagcatattgagaaccttgaagagcagaaaaagcccg
actccctcggctgggacgatatagcgcaggagatagtcggggcgataaccttcgccctacccttcatcttcacggaggaa
ctctgggacatagccaaggacatttcggttgggcgctctatagcgatactcattatgacactcggcgttgcgtatctctt
catagccaaatcgcggataggaaacctgaagagggaggagctctttcacgtgcccaagaggctcctgaccgtcaccctga
tagcctacctgacgtcggccgttctgatatacctctacgggataaacaacctcgccgacttcacggccattcagtacatc
aacgcgaccatactcgtgagcaccttcgcggtcatcggcgcgataacggttgatatggtgagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1371621 - 1373163 (Additional range around tg1461 is :500nt.)

>Thermococcus gammatolerans EJ3 CCAAAGCGCTCCACCCTGTCGATCGTTCCCTTGTAAACGTTTCCGATCTCAACGTCCTCGTAGTCGCAGGTCTTGTCGAG GATGTAGACGACCTTGTACTTCCTCAGGCAATCAGGACATACCCACGTCGTCTCCATACCCGGTTCCCAGGGCCCTCTTA TCTTGCCGCAGATGTCGCAGGCGAGTACCTTGCCCGTTCCCCCGCATGTTGGACAGGTGTCGTAAACCGGCACGGTTCCC TTACCGTGACACTCGGGACACGGAATCTCGTCAACTTCGTCTTCAACGCCAAAGTAATCGAGATTTCTGTAACCTTTGAG CTTGTCCCCGATTTTAAAGTCAGCCGGAACGTAGCCCCAGCCCTCACAAACGGGGCACTCCTTCTCGCCGACCTTAACCT TTCCCGTTCCGTGACACTCGGGACACTCCTTGACTACCATCGCTCCCACCACCGGTAGAATCTGACATGGTCTTATAGTC TTTTCCCAAACGGTTTTATA gtgtcgggaagagtgaaaaccgcgatgatgagtgaatccaatgctgatgggatgatgag ccccgaacctgagcgcgaggtggttgaactggaaaaactccggaagagtgttgaagagctcacgaagcatattgagaacc ttgaagagcagaaaaagcccgactccctcggctgggacgatatagcgcaggagatagtcggggcgataaccttcgcccta cccttcatcttcacggaggaactctgggacatagccaaggacatttcggttgggcgctctatagcgatactcattatgac actcggcgttgcgtatctcttcatagccaaatcgcggataggaaacctgaagagggaggagctctttcacgtgcccaaga ggctcctgaccgtcaccctgatagcctacctgacgtcggccgttctgatatacctctacgggataaacaacctcgccgac ttcacggccattcagtacatcaacgcgaccatactcgtgagcaccttcgcggtcatcggcgcgataacggttgatatggt gagg TGAATGAAACTTGTAACCGGAAAGCACTGGGAGGCCTTCGCCGACGAAAACTCGCTCCTCTTCCCCGAGTACAGG AAGAACCGTGACGAGCTGATTGGCTTCGTGGGCTCACTGAAGGGAGACGAGACCATCGTGACTGCCAGTTTAGAGCTGAT AGACCTTATCACAAACCGCTTCAGGAAGGGCGAGGAGAACGTTCTAATTTACTCGGACACGGGCAAGATCTTAACCCTGA AGGAAGTCTACGAGCTTAGGAAGTACCTCGACTTTGACGTGAGAGGGGGTTTCTCGGGAGAAAGGGCTAAAGTGAGCATA CTCTTCGTCGAGGGGAAGACCGACGCCAAGTTCTTCAAGGCCGTTTTCAAGAAGCTCTTCGAGTTCAGGGAGAGCCGAAA TGCTCCACACCAGTTCCGCTTCATAGAGCGCGTCTTTGAGCGCGACAACTTCGACCTTCTGAAGAGGGAATCGGACGGAG TTTACCTCGCCGTTATCCCGAGCG