tg1474

Coordinates:1386585-1387484

>tg1474 hypothetical protein TGAM_1474
MGMKKLLALVLLFLLFFAYNACTYHQLSSAEGAYKLAGISGDEKLIAVYHDSNFWQFATYNPKARELKVYYLSQAHPLDF
RIKKTKTVKTPLNYSPLALDLKLLEKAPKETPALLFAGKWYTPENPPEFPSFDEIIKGYTNKTIRRIALLYARKELWIQT
YLQVTARAYEVGTKDVLVIPSFGNTSGGIWVVETPQGKNSTKTVYYPGTKIVGNVTPVYLGSFVLNNRNSIESALYEALS
NLSKTTSFAKIEVYCFSPQADVDTVTIKRYYQGISMEKYFQFYYLHRDTIKVLGGCKTTR

>tg1474 hypothetical protein TGAM_1474
gtggggatgaagaagctccttgctttggttttacttttccttcttttctttgcctataacgcgtgcacttaccaccagct
ctcctcagcggaaggggcttataaactggcgggaatttcaggagatgaaaagctcattgcagtctatcacgatagtaatt
tctggcagttcgcaacgtacaacccgaaagcccgagaactcaaagtctactacctcagtcaggctcatccattagacttc
agaatcaagaaaacaaaaactgtgaagacacctttgaactattcccctctcgcccttgacttaaaactccttgaaaaagc
accaaaagaaactcctgcattactcttcgccggaaaatggtacactcctgaaaacccgccagaattcccaagctttgacg
agataatcaaaggatacaccaacaaaacgatccgaaggattgccctcttatacgcgaggaaagaactctggatacaaaca
tacctccaagtgaccgcaagagcctatgaggtgggaacgaaggatgtactagtaattccaagttttggaaatacctccgg
gggaatctgggttgttgagactccgcaaggaaagaactctaccaaaactgtgtactatccgggcactaaaatagtaggga
acgttaccccggtgtacttaggttcatttgttttaaacaacagaaattctattgagagtgcactttatgaagcgctttca
aatctcagcaaaaccaccagcttcgcaaagatcgaggtttactgcttctccccacaagccgatgttgatactgtaaccat
caaaagatactaccaagggatctctatggaaaaatacttccaattctactacctccacagggacacaattaaagttttag
ggggatgcaagactactcgc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1386085 - 1387984 (Additional range around tg1474 is :500nt.)

>Thermococcus gammatolerans EJ3 CCCCTTACCTGCTCCGAACTCCTGAAACTGTGTTCTTCATGCAAGCTCGTCCTCGGAGAAGGTGGGGACAAAGTGAGACT TGGATACACGAACCTCACAAGTGGTTACTTAGTCGTGCCCTCTCCCAGAGGTAGCTCCAGATTCGTCCTTGAAATCAAAT CTTACAACGCAACCAAAGATGCCATAATCGCTAAATACCCAATGGGAATTGTCAAGGGTTATACCTCGAAGCTCAACCTC CCCCCGATTGAAAACACGAGCCTTCCAGCCAACGTTTCCCAGTACCTGGAGCCCGCATGGGGGATCCTGATAACAGGAAA TGAAGTGGTGCTCAACCCCGACCCCTGGAGCATTGTTGAGGAACTGGGAGAATGCAGAACCGTGTACAAAATTACAATTC ACAACAACGGAACAATAGAAAAAACAGAATATGGGCTGCCCTGCTGGAGAAGGTAAAACTAAAACCCCTACAATAGTGTT GGTTACTTTATGGAGGTGAT gtggggatgaagaagctccttgctttggttttacttttccttcttttctttgcctataa cgcgtgcacttaccaccagctctcctcagcggaaggggcttataaactggcgggaatttcaggagatgaaaagctcattg cagtctatcacgatagtaatttctggcagttcgcaacgtacaacccgaaagcccgagaactcaaagtctactacctcagt caggctcatccattagacttcagaatcaagaaaacaaaaactgtgaagacacctttgaactattcccctctcgcccttga cttaaaactccttgaaaaagcaccaaaagaaactcctgcattactcttcgccggaaaatggtacactcctgaaaacccgc cagaattcccaagctttgacgagataatcaaaggatacaccaacaaaacgatccgaaggattgccctcttatacgcgagg aaagaactctggatacaaacatacctccaagtgaccgcaagagcctatgaggtgggaacgaaggatgtactagtaattcc aagttttggaaatacctccgggggaatctgggttgttgagactccgcaaggaaagaactctaccaaaactgtgtactatc cgggcactaaaatagtagggaacgttaccccggtgtacttaggttcatttgttttaaacaacagaaattctattgagagt gcactttatgaagcgctttcaaatctcagcaaaaccaccagcttcgcaaagatcgaggtttactgcttctccccacaagc cgatgttgatactgtaaccatcaaaagatactaccaagggatctctatggaaaaatacttccaattctactacctccaca gggacacaattaaagttttagggggatgcaagactactcgc TAATTCAGGTGAGGATCTAAAAATGATTTGAGGGAAGG CCAATATTGAGATTTGGAAACTAACGAGCGTCGGCTACTTTATGGAGGTGGTTTGGGGATGAGGCGGAAGTTGTTTGCTC TCTTTCTTTTACTCACTCTCCTGCTCGGGTATTTGGCTTATTTGAACTCCCTCCCACTAGCAGTCAGAGCTTACAAACTC GCAAGAATCCCCAGCGACGAACAATTAATAGCAGTTTACCACGACAAGGACTTCTGGCAGTTCGCCACTTACAACCCCAA AACCCAAAAACTGAAAGTTTACGCCCTTTACACTGACAAACCAATCCTCCCCTGGGGAAGAGACGTAAAAACCGTAAAAA CACCATTAAACTACTCCCCACTCGCCCTTGACTTGGACCTTCTTGAAGAAGTACCAAAGGAAACTCCCGCATTACTCTTC GCCGGAAAATGGTACACGAAAGAAAACCCGCCAGAATTCCCAAGCTTTGACGAGATAACCA