tg1482

Coordinates:1394081-1394296

>tg1482 hypothetical protein TGAM_1482
MLMKKKSIERDPIWKAVGALTISDENASEREDWLLTEEWAGFNSTKSNVFGILKGWKTDPQKLKDKLRGEWE

>tg1482 hypothetical protein TGAM_1482
gtgctgatgaagaagaaaagcattgagagagaccctatatggaaagccgtgggagcgctaacgatatccgacgagaacgc
cagcgagagggaagattggttgctcacagaggaatgggcgggcttcaactccaccaaatcgaacgtcttcggcattttaa
agggctggaaaaccgacccgcagaagctcaaagacaaacttcggggggagtgggaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1393581 - 1394796 (Additional range around tg1482 is :500nt.)

>Thermococcus gammatolerans EJ3 ATGGGCGAGAAGACCCTTGAGAAGGTCAGGAAAATCTGGAACCAGCTGAAGAAGTACCACTACGGCGGAAAGGCCGAGCT AATCGTTGTCAAGCCGAAGGAGCGCAAGAGAATCATTGAGAAGCTGAAGGAACTCGGGAAGGAGAAGTACACCTGCGTGT TCTGCAAGTTCATGATGGTGAGGCACGCGGATAAGATAGCCAAGGACTTCGGCGCGAAGGGCATCGTGATGGGCGACTCC CTCGGGCAGGTGGCTTCGCAGACGCTCGAAAACATGTACATCGTCAGCCAGGCGAGCGATTTACCGATTTACAGGCCGTT GATAGGCATGGACAAGGAGGAGATAGTTAGCATAGCGAAGAGAATCGGAACCTTCGAGCTGTCCACCCTGCCTGAGGACG AGATACCCTTCATCCCGAGGCACCCGATAATAAGGGGCTCGTGGGAGGAGTTCAGGAAGCTCTACAGGGCGGTCTTCGGA GAGGAGCCGAGGAAGAGGGA gtgctgatgaagaagaaaagcattgagagagaccctatatggaaagccgtgggagcgct aacgatatccgacgagaacgccagcgagagggaagattggttgctcacagaggaatgggcgggcttcaactccaccaaat cgaacgtcttcggcattttaaagggctggaaaaccgacccgcagaagctcaaagacaaacttcggggggagtgggaa TG AGTCCCACACGCTTCGCCTCCTACGTAGCCCTCTCCCTCCCCATCATCTTCATCGTGGGCCTAACAGTGGTTATCCACGC AAACCCCTGGTTCTCGCTCCAGAACAACGCGCTGAGCGACATGGGGTCGCTCAAGAACCCCAACCGCTGGCTCTTCAACG GCCTCCTGATGCTCTTCGCCGTGATTGCAATGGTTCCGTCAGTGGTAGCATTCAAACACGGACTCTCCTACCTGATGCCC CTCGCGCTCCTTTTCCTATTCCTTGTTGGGGTTTTCCCCGAGGAGCTCCCCTATCACGCTCCCTCGGCAGTGTTATTCTA CGTTCTGGCACTGGCAGACATAGCGCTCGTCGGGATAAAGCTCGGCCGTCAGAATTCGGTCAACTACCTCTGGAGCGTTC TCTCGGTTGTCGTGTTCATCACGATGCTCTACCTGATTAGGGCGAGGGTGTTCAAGGGGCTGGCGATTCCGGAGCTGATA GGAGCGTCCTTCATCCT