tg1507

Coordinates:1413223-1414068

>tg1507 hypothetical protein TGAM_1507
MRRLELSSDIAIEMYDSRSYGNRVIRESIGAMFDIARELKGKVVLVGGWGVYYWVDNFLGYRGVPSIDIDFLAKAESFDE
IREVMENLGFQSAGFRFVKPVEDFIVREEVKVDFLFDERPSGLSFDTPFASPLFANRYHSRVHFAVNDFEGTPIADGKLD
VAFPEAILALKFDIYTNITDYPDDKRAKHWKDVVDVYSLVMGFYRRRDRWRGEGFYLRRDVLRELYRVKAYRPTAIYRVL
EDSPYKNDIQAIISNYVGFGVFEERLFQRRLRELEEIASAGL

>tg1507 hypothetical protein TGAM_1507
ATGAGGAGGCTTGAGCTCTCCAGCGATATCGCCATCGAGATGTACGATTCGAGGAGCTACGGAAACAGGGTCATTAGGGA
ATCCATTGGGGCAATGTTTGACATCGCCCGGGAGCTGAAGGGAAAGGTGGTTCTCGTTGGTGGATGGGGCGTTTACTACT
GGGTGGACAACTTTCTCGGCTACCGCGGAGTTCCGTCCATTGACATAGATTTCCTTGCGAAAGCGGAGAGCTTCGACGAA
ATCAGGGAGGTCATGGAAAACCTCGGCTTTCAAAGCGCCGGCTTTAGGTTCGTGAAGCCGGTTGAAGACTTCATCGTCAG
AGAGGAAGTGAAGGTGGACTTTCTCTTCGACGAGAGGCCGTCGGGGCTTAGCTTTGATACGCCCTTTGCATCGCCACTCT
TCGCGAACCGCTACCATTCCAGGGTTCACTTTGCCGTGAATGACTTCGAGGGCACTCCAATAGCGGACGGAAAGCTCGAC
GTAGCCTTTCCAGAGGCGATTTTAGCTTTGAAGTTCGACATCTACACAAACATCACAGACTATCCCGACGACAAGCGAGC
AAAGCACTGGAAGGACGTGGTTGACGTTTACTCCCTCGTTATGGGGTTTTACAGGAGACGAGACAGGTGGCGCGGCGAGG
GATTCTACCTGAGGAGGGACGTCCTGAGGGAGCTCTACCGCGTTAAGGCCTACAGGCCAACCGCCATTTATCGGGTTCTC
GAAGACAGCCCGTACAAGAACGATATCCAGGCGATAATCTCCAACTACGTGGGCTTTGGGGTCTTCGAGGAGAGGCTCTT
CCAGAGGCGGCTGAGGGAGCTTGAGGAGATAGCCAGTGCCGGCCTT


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1412723 - 1414568 (Additional range around tg1507 is :500nt.)

>Thermococcus gammatolerans EJ3 GGGCTGAACTACACCTACACCTACCAGGTCGTGAGGTCTCTCGTGAGGGAGGGCTACGTAACGGTCGTCGGGGGAAGGGT CGTCTTTCTTGACAGGAAGGGCTTTCTCTTCAAATGGGCCGGGGACAAGGAGAGAATATTGGGCTCCCTTGGCTACGCGA CTGTTAAGCTCATCCCGGACTACGACCTCAGGGAGCTCGTGCTCTTCTCCGGAAACTCCGCGCTCTGGCTCCTCGGTAAG ATAATCAGCCCCGCGGGCGGAATCCTCTACACGACCGCCGATAGGTTTGAGGAGGTCATGGAGCTCAAAGACCCCAACGG CTACCCCTTCAAGCTCTACATCTACGACGAGTTCTACTTCAGAATCCGAAAGGAGCTCAGCGGCTACTACATCCCGAGCT GGGGGATGATTGTGGCAGATACTCTCGTTCAGGGGATGTACGCAAGGCTATTTAATGACGTTTTTGAAACCGTGGTTTCC ATCATCAAGGGTGGGAAAG ATGAGGAGGCTTGAGCTCTCCAGCGATATCGCCATCGAGATGTACGATTCGAGGAGCTAC GGAAACAGGGTCATTAGGGAATCCATTGGGGCAATGTTTGACATCGCCCGGGAGCTGAAGGGAAAGGTGGTTCTCGTTGG TGGATGGGGCGTTTACTACTGGGTGGACAACTTTCTCGGCTACCGCGGAGTTCCGTCCATTGACATAGATTTCCTTGCGA AAGCGGAGAGCTTCGACGAAATCAGGGAGGTCATGGAAAACCTCGGCTTTCAAAGCGCCGGCTTTAGGTTCGTGAAGCCG GTTGAAGACTTCATCGTCAGAGAGGAAGTGAAGGTGGACTTTCTCTTCGACGAGAGGCCGTCGGGGCTTAGCTTTGATAC GCCCTTTGCATCGCCACTCTTCGCGAACCGCTACCATTCCAGGGTTCACTTTGCCGTGAATGACTTCGAGGGCACTCCAA TAGCGGACGGAAAGCTCGACGTAGCCTTTCCAGAGGCGATTTTAGCTTTGAAGTTCGACATCTACACAAACATCACAGAC TATCCCGACGACAAGCGAGCAAAGCACTGGAAGGACGTGGTTGACGTTTACTCCCTCGTTATGGGGTTTTACAGGAGACG AGACAGGTGGCGCGGCGAGGGATTCTACCTGAGGAGGGACGTCCTGAGGGAGCTCTACCGCGTTAAGGCCTACAGGCCAA CCGCCATTTATCGGGTTCTCGAAGACAGCCCGTACAAGAACGATATCCAGGCGATAATCTCCAACTACGTGGGCTTTGGG GTCTTCGAGGAGAGGCTCTTCCAGAGGCGGCTGAGGGAGCTTGAGGAGATAGCCAGTGCCGGCCTT TAAGCTTCGAAAG GCTTATCTCCCATGAAGGCGAAGTTTGATGGGTGATGTCCTTGTCGCTTTTGCCGTTGGCAGGGATGTTCATCTTCGGAG GGAAGAAGAAAAAGCGGACGAGAGAAACGAGCGAGAAGAGTACGAAAAGAAACTCGAAGAATTAAGCAAAAGATACGGCA TCCCAAAAGAAAAAATATTAGAAAAATGGCACTATTTAGAGTTTACAATGGAGGACAAGCATATTGTCGCAATAACTTTT TGCAGGGACTGGAAAAGAACGAAATTCGAGTTTTTTCAAGTTTAAGAACTGCTGACTTCACTCAAAAACAAAATCAAAAG AAGACCGAAGGCATCAGCCCTTGGCGACGCCCATCGGGCGCATCCTCGCGACGAGCTTTGCTATGCCAGCCTGGTGGACG ACGTTGACGACGTTATCGACGCTCTTGTAGGCTCCGGGAGCTTCTTCGGCCACAACGCGGAGCGAGGCCGCGCGGACGTA GATCCCC