tg1513

Coordinates:1418404-1419084

>tg1513 Hydrolase, HAD superfamily, Putative phosphoglycolate phosphatase (gph)
MIRGLIFDVDETLLYYEGYTLRRWYEEVGRPAMEKLGVLLDWETFRRIVRGELSRRYVERFGIDHVEFWKAMDRANKAYR
ERLLEEGKIKPFPDAGALEELRALGLKLAAVSNASQDNTELVLKAFGLDRYFDVILGKDYSYLDGVKPNPYLLNKALKVL
GLKKDEVLLVGDSSNDVLAGRNAGIKTVNIVRFERVPGADYYVNTLWELVNLVKELRAKNPLGLSPR

>tg1513 Hydrolase, HAD superfamily, Putative phosphoglycolate phosphatase (gph)
atgattaggggactcatattcgatgtcgatgagaccctcctctactacgagggctacaccctgcggaggtggtacgagga
ggttggaaggccggcgatggagaagctcggcgttctcctggactgggagaccttcaggagaatagttcggggggagctct
cgaggagatacgttgagcggtttggaattgaccacgttgagttctggaaggctatggatcgggccaataaggcctaccgg
gagaggcttctggaggagggaaagataaagcccttccctgacgctggcgctcttgaggagctcagggctcttggtctaaa
gcttgcggccgttagcaacgcctctcaggacaatacggagctcgtgctcaaggcgtttggtcttgacaggtacttcgacg
tgatcctcggaaaggactactcgtacctcgacggtgtaaaaccaaacccctatctcctcaacaaggctttgaaagttctc
ggcctgaagaaggacgaggtcctgctcgtcggggacagttccaatgacgttctggcggggcgaaacgcgggaattaagac
cgtgaacatcgtgcgctttgagcgcgttcccggtgccgactactacgtgaacaccctttgggagctggtgaacctcgtta
aggagcttcgagcgaaaaacccattaggcctttcaccaagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1417904 - 1419584 (Additional range around tg1513 is :500nt.)

>Thermococcus gammatolerans EJ3 AGAGCGACACGCCGGAGAAGAGGAGAACCCTCAAGGTACATCCATACGGGAACCCGAAGAACCCGCTCACAGGTGTTTTC GCAACCCGCTCGCCCTGCAGGCCGAATCCAGTGGCGCTTTACACCGTCAGAATCCACCGCATCGAGGGGAGCAGGCTCTA CATAGACGAGATTGACGCCGAGGACGGAACTCCCGTGGTGGACATTAAGATTTTCGTCGAGCGCTACGACTGCCCCAAGG AGGTGCCGATAGAGGAGCGGGAAGCCGAGATAGGGGCCGGGAGAACGATTGGCGAGGTGAACATAATCCCGAGGAAAGCC GACCACCTGGACGAGCTTGAGGAGGTCTCGCCGGAGGAATACGACGCGCTGATACTCGAAATCGGCCCGAAGACGACGAC ACTTACAGCCAAAGAACTCGTCGAGCTCATCGAGGCCCTTCAGGAGGTCTATGAGAACCTGCCGGTGGAGATAAAGGATA AACTGCGGGGGATGTTCCA atgattaggggactcatattcgatgtcgatgagaccctcctctactacgagggctacacc ctgcggaggtggtacgaggaggttggaaggccggcgatggagaagctcggcgttctcctggactgggagaccttcaggag aatagttcggggggagctctcgaggagatacgttgagcggtttggaattgaccacgttgagttctggaaggctatggatc gggccaataaggcctaccgggagaggcttctggaggagggaaagataaagcccttccctgacgctggcgctcttgaggag ctcagggctcttggtctaaagcttgcggccgttagcaacgcctctcaggacaatacggagctcgtgctcaaggcgtttgg tcttgacaggtacttcgacgtgatcctcggaaaggactactcgtacctcgacggtgtaaaaccaaacccctatctcctca acaaggctttgaaagttctcggcctgaagaaggacgaggtcctgctcgtcggggacagttccaatgacgttctggcgggg cgaaacgcgggaattaagaccgtgaacatcgtgcgctttgagcgcgttcccggtgccgactactacgtgaacaccctttg ggagctggtgaacctcgttaaggagcttcgagcgaaaaacccattaggcctttcaccaagg TAACTTCGGTGATGATAT GGGCTGTGGAATGGCGGTTGATGCGAACCGCGTTATAGCCGGGGGTGTGCTCGTTTTCGTTGAGCCAGAAGACTTCAAGA AGTTCCTGGAGCTCAAGAAGAGCCCGCTGGTGATAACTGGCGAAACGGGCGGCTTTAAAAAGGCAAAACTAACTATGACG GTCTACGACGGTGCCGTGATAATCACGCGCGGGGAAGTCGAGCTGCCCGAGAAAGCCATCGTGATAAGGGCAAAGAACCT GTCCCTTGGCAAGTGATATATCAAACTCTACATATTTTTCTTCGGTCTTAATAACCCACCGTAATGCTTAAAACCCGCAG GTCTTATAAAACCGGGAAACAAGGGGCATCGGTGATTAAAATGGTCAGGTACATGGTAACCTCGGCACTCCCTTACGCTA ACGGCCCGATTCACGCGGGCCACCTGGCGGGAGCGTACCTTCCAGCGGACATCTTCGTCCGCTATCTGAGGCTCAAGGGC GA