tg1521

Coordinates:1426948-1427511

>tg1521 Cyclase, putative
MIVDLSLPLGEETPVYPGDPEVKVKPWAFIERDGYYMNALKLGEHSGTHVDAPAHFIPGGKTIDEMPLEKFIGEAFVVDV
RDGEGTVKLDEIPDSGYYGKIVLFLTGGRELSPEVALFLVAEGAKAVGTDAMSIGDDTVHTILLTAEVPVFENLANLEVL
LEKTFTFIGLPLKIEGGSGSPVRAIALL

>tg1521 Cyclase, putative
atgatagtcgacctctcgcttcccctcggagaggagacgccggtttatccgggcgaccccgaggtgaaggtcaaaccctg
ggccttcatcgagcgcgacggctactacatgaacgcccttaaactcggagagcactccgggacgcacgttgacgctccgg
ctcacttcattcccggcggaaagacgatagacgagatgccccttgagaagttcatcggcgaggcctttgtcgttgatgta
cgcgacggggagggaaccgttaagctcgatgagattcccgactcgggctattacgggaaaatcgtccttttccttaccgg
cgggagggagctctcacccgaggtcgcgctcttccttgtggccgagggtgctaaagcggtcggcaccgacgcgatgagca
ttggcgacgatacggttcacactattctcctgaccgctgaggtgccggtcttcgagaacctcgccaaccttgaggtcctg
ctcgagaagacgtttaccttcataggccttcccctgaaaatcgagggtgggtcgggaagtcctgtaagggccatcgccct
gcta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1426448 - 1428011 (Additional range around tg1521 is :500nt.)

>Thermococcus gammatolerans EJ3 GCCCCAGATTTCGTCTATTAACTCAGGCCTTTCGCGGTGTACGGTGCTTATCATATCGGCACCATCGTCTATGATGATGT TGGGCCTTATGTCCAAAGCCCTGTGCATGTTCTCGTAGTACTCCTCCCTGCTCTCTCCTCTAATCGCGTAGACCTTGACG CCGGCCTTTGCCAGGGCCGCGACCACGTCGTCCTGCGTCGAGAGAGGATTGCTGGCCGCGGCCGAGACCTCAGCTCCTCC TGCCTTAAGGGTCAGGAGCAGGAAGGCCGTCTTCATCTCAAGGTGGAGCGTCGTGGCGATTCTGACGCCCTTAAAGGGCT TCTCCCTCTCGAACTCCCCCCTTATCATCTGGAGGACGGGCATGAAGCGCGAGACCCAGTCAATCTTCTTCTCCCCGCTC GGTGCCAGGTTTATGTCCTTAATGCAGTAATCCTTCGTGCAGTCCATAACAACCACCGATGGGTTTTTAATTCCGTGAGT TAAAAAGGGTTGGTGTTGTC atgatagtcgacctctcgcttcccctcggagaggagacgccggtttatccgggcgaccc cgaggtgaaggtcaaaccctgggccttcatcgagcgcgacggctactacatgaacgcccttaaactcggagagcactccg ggacgcacgttgacgctccggctcacttcattcccggcggaaagacgatagacgagatgccccttgagaagttcatcggc gaggcctttgtcgttgatgtacgcgacggggagggaaccgttaagctcgatgagattcccgactcgggctattacgggaa aatcgtccttttccttaccggcgggagggagctctcacccgaggtcgcgctcttccttgtggccgagggtgctaaagcgg tcggcaccgacgcgatgagcattggcgacgatacggttcacactattctcctgaccgctgaggtgccggtcttcgagaac ctcgccaaccttgaggtcctgctcgagaagacgtttaccttcataggccttcccctgaaaatcgagggtgggtcgggaag tcctgtaagggccatcgccctgcta TGATTCCTCGGATTCCTCCCGTTCTAGGAGCATCTTAAGGGCCTGGGATAGCTT CTCGTTCTTCTCCCGGAGAAAGGCGTTTTCCCGCTCCAGTTCCTCAAGGCGTTCTTGGAGACGCTTTAGCTCGCTGAGAA GGGGAGCAACCTTTGATTTTGGAACGTATTCCTCCTTCATGCGTCTGACAGCTTCGAGGGCCTCTTCAAGGGAACCAGCC CCGGTCAGACGGAGAAGCTCACGTTCGGCCTTTGAGAGCCTTCCAGTCTTTTTCTCGTACTCCTGAACCCTTCTCTGGAG TTCCTCGATCCTTCTGTTCAGCTCGGCGTAGCTGGAAACTTTCTTCCTCAGCTCCGCAAGTTCTCCCTCCTTCTTCCTGA GGGCCCCCCGGAGGCTCTCAACCTTACGCCTCAACTCATAGTTCTCAATTATGAGCTTCTCGTGGCGCTCCTGTAGCTCC CTCAGGGATTTTGCGAGGTCTCCGCTGACTCCCAGGATAGATCCC