tg1533

Coordinates:1438692-1439354

>tg1533 Flagellin B1 precursor (flaB1)
MKAKNRRGAVGIGTLIVFIAMVLVAAVAAAVLINTSGFLQQKASSTGRQSTEQVASGIQVMRVTGHYDGSSGIDKLAIYV
TPNAGSSGIDLSNTRIVLSNGDKQAILKFAKNNVTSTLPSNIFDTSLTAWDYINYGGTKGYTYYGIIVVQDYDGSLTEST
TTPTLNKGDIAILTVDVNGLFGASIDVRKHITGQVVPEFGAPGVIDFTTPSTYTTDVVELQ

>tg1533 Flagellin B1 precursor (flaB1)
atgaaggccaagaacagaagaggtgcggttggtattggaaccttgatagtgtttattgccatggtgctagtggcggcagt
ggctgcagcagtcctcatcaacacgagcggcttcctccagcagaaggcttcaagcaccggcagacagagcaccgaacaag
tcgccagcggaatacaggtcatgagggttacaggacactacgatggatccagcggaatagacaagctcgctatctatgtc
actccgaacgccggcagctcggggattgacctcagcaacacaaggatagtactgtccaatggtgacaagcaggccattct
gaagtttgccaagaacaacgttacgagcactcttccgagcaacatattcgacaccagcctgaccgcatgggattatataa
actatggaggcacgaagggatacacctactacggtatcattgtcgtccaggactatgacggatccctcacggaatcaacc
acaacgccgaccctcaacaagggtgacatagctatcctcaccgttgatgtgaatgggctgttcggtgcttctattgatgt
caggaagcacattactgggcaggttgtccccgagttcggtgcaccgggcgtcatcgacttcaccaccccaagcacctaca
ccaccgatgttgttgaactccag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1438192 - 1439854 (Additional range around tg1533 is :500nt.)

>Thermococcus gammatolerans EJ3 CGAACGTTCGATGGATCGGACCCAACAACCCTGGCGATCTCAGAAAGGTAAGTTGCCGACGGGTATATCTCATTCAGGTA AAGGAGAATTCTCTTTCTCAGCTCACTCCTGTGTAGGGACCTCAACACTTGTGGGTCTATGATCATTGTCCTTACGGCCA TCCGCCCCCACCTCCAGTGTTACTCTGCGGCCTTTAGCCCGCTGATTTTACTGCCCCACTGACCATCTATGGCAGCCAAC ACTTTGTTTGTTTGGATACTATATAACGTTTTTGGTTTTGAATTGTACTCATTCCAGCATTTGTCCATTTAATCTGCTGC CAATGCATTGAATATAATTTATTTTGCAGGATTTTCAAAATCTGGTCAGGAAATTTCCAAAACCCGAGGACTACCTACAT ATGCACCTACACAACCAGCTACACTACTAAGAACAAAAAAGCGATTTATATCGTAAGCTTGTAATCATTAATGCAAACAA CCCCAGGGGGTGCATGGCTG atgaaggccaagaacagaagaggtgcggttggtattggaaccttgatagtgtttattgc catggtgctagtggcggcagtggctgcagcagtcctcatcaacacgagcggcttcctccagcagaaggcttcaagcaccg gcagacagagcaccgaacaagtcgccagcggaatacaggtcatgagggttacaggacactacgatggatccagcggaata gacaagctcgctatctatgtcactccgaacgccggcagctcggggattgacctcagcaacacaaggatagtactgtccaa tggtgacaagcaggccattctgaagtttgccaagaacaacgttacgagcactcttccgagcaacatattcgacaccagcc tgaccgcatgggattatataaactatggaggcacgaagggatacacctactacggtatcattgtcgtccaggactatgac ggatccctcacggaatcaaccacaacgccgaccctcaacaagggtgacatagctatcctcaccgttgatgtgaatgggct gttcggtgcttctattgatgtcaggaagcacattactgggcaggttgtccccgagttcggtgcaccgggcgtcatcgact tcaccaccccaagcacctacaccaccgatgttgttgaactccag TGAGGGAGGTGAAAGGATATGAAACTTGTTAAGAA GAGGGGTGCGGTTGGTATTGGAACCTTGATAGTGTTTATTGCCATGGTGCTAGTGGCGGCAGTGGCTGCAGCAGTCCTCA TCAACACCAGCGGCTTCCTCCAGCAGAAAGCTTCAAGCACCGGAAGGGAAAGCACCGAACAAGTCGCCAGCGGAATACAG GTCACCAGCGTCGTTGGATGGGTCAACAACAGTGGAGTCTCCAAGCTCGCCATCTACGTTACTCCAAACGCTGGCAGCGC TGGCATTGACCTCAAGAACACGAAGATAATCCTCTCCGATGGAAAAGTAGAAGGAATACTCAGGTATGGTAACGACACTG ATGCCTACGTCGTTGGACCAGTCTCAGACGTATTTCAGGATGTCATAACACTGAATGGATACACCTTCAACTGGTCCAAA CTCGACAAGACCACATATGGTATCATTGTCGTCCAGGACTATGATCACTCAGTCCAGAAGCAGG