tg1536

Coordinates:1440758-1441405

>tg1536 Flagellin B5 precursor (flaB5)
MPRRRGAIGIGTLIVFIAMVLVAAVAAGVLIATSGYLQQKAMSTGRQTTQEVASGIKVMNIYGYTPANPPSAGNITKLVI
YVTPNAGSSGIDLSYVKVVLSDGSKMTVFKYNPNAFYTGDIDNVFTLPVWVNVTGTNFGIAVVQDSDLSIINNREHPVLN
WGDIAALLVNTTGFGKGAGLPPATHVTGKVIPENGAAGVVDFVTPHAYTDKILTLQ

>tg1536 Flagellin B5 precursor (flaB5)
atgccaagaagacgcggtgcaattggcattggaacgctcatagtgttcatcgcaatggtcctagtggctgcagtagccgc
cggagtgctaatagccacgagcggttacctccagcagaaggccatgagcacaggaaggcaaacaacacaggaagttgcca
gcgggattaaggtcatgaacatctacgggtacacaccagcaaacccaccaagtgccggaaacataacgaaacttgtcatc
tacgttactccaaacgcggggagtagcggcatagatctcagctacgtcaaggtcgtcctcagcgacggctccaagatgac
cgtcttcaagtataaccccaacgcattttacactggggacatagacaacgtattcaccctgcctgtctgggtcaacgtaa
caggcacgaactttggcatagcagtggttcaggattcagacctcagcataattaacaacagagagcatcccgtcctgaac
tggggtgatatcgcggcactgctggtgaacactacaggatttggcaagggtgctggattacccccagccacccacgttac
gggtaaagtaataccagaaaacggcgccgcaggagtcgtggacttcgtaacaccacacgcatacacggacaagatactta
cactgcag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1440258 - 1441905 (Additional range around tg1536 is :500nt.)

>Thermococcus gammatolerans EJ3 CGTCAACATCTACGGCTACACGCCCACCAATCCCCCAAGCAGTGGGCTCATTGAGAGGATGGCCATCTTCGTAACACCAA ACGCAGGGAGTGAGGGAATCGACCTCAGCAACGTTAAGATAGTCCTCAGTGATGGGAAGAGGCTCGTGGTGTACAATTAC TCCGCTCAGTTCCTCAACCCCGGCAACATCAACGATTTATTCAACACTACTGAGATAAGCCTCTGGAACAGCATCCAGGG TACAGCAAGCTTCGGAATAGTTGTTGTCAATGACATAGGAAGCAGGATGCAGGACACCCACCCAACGCTGGAGTTCGGTG ACATGGTGGCGCTCTGCATCTGGACCACAATGTTCCAGAGCGATGGTGGCAATGGCATAGGCCCAAGCACGAAGATAACA GGAAAAGTGATACCGGAGCGGGGAGCCGCTGGAGTTATCGACTTCACGACACCCGCCACGTTCAGTGAGAACGTGATGCA ACTCCAGTGAGGTGGTGAAA atgccaagaagacgcggtgcaattggcattggaacgctcatagtgttcatcgcaatggt cctagtggctgcagtagccgccggagtgctaatagccacgagcggttacctccagcagaaggccatgagcacaggaaggc aaacaacacaggaagttgccagcgggattaaggtcatgaacatctacgggtacacaccagcaaacccaccaagtgccgga aacataacgaaacttgtcatctacgttactccaaacgcggggagtagcggcatagatctcagctacgtcaaggtcgtcct cagcgacggctccaagatgaccgtcttcaagtataaccccaacgcattttacactggggacatagacaacgtattcaccc tgcctgtctgggtcaacgtaacaggcacgaactttggcatagcagtggttcaggattcagacctcagcataattaacaac agagagcatcccgtcctgaactggggtgatatcgcggcactgctggtgaacactacaggatttggcaagggtgctggatt acccccagccacccacgttacgggtaaagtaataccagaaaacggcgccgcaggagtcgtggacttcgtaacaccacacg catacacggacaagatacttacactgcag TGAAAGGGGGGTGGCACAATGGCACTGACTTTCCTTTCATCTTTATTTGG GAAGAAGAAAAAGGAGGAAGCGGCCACCCCCGTCGAGGAGCCAATAGAGGTTGAAGAACTCGAAGAGACCGTCGAAAACA GGGAGGAGAACGAGCAGATAAACCAGCTCATGGAGAGGATAAACGAAATCGAGAACGATCTCCCAAGGATAAAGATAAGC ATCGACACCATAAAGAAGCAGATACAGGAGCTCAGAGATGACATAGATAGGCTCGACAAGACCATCAAGGACGTCATGAT GCTCTACGAGGTCATCAGCCAGGAGATAAACCCGTTCAAGGAGCAGATGGGTCAGGAAAATCCGCTCAGCAACGAGATAC AGGAGCTCAGAAAGGAACTGGAGAATCTCAAGATGGAGCTGGCCCAGGTCAAGAACGACATCAAGGTGCTCGCCGGGTAT GGTGTGGACATAGACTCGATAATCTACGAGGTGCTGGCGGAGGTGTGAT