tg1537

Coordinates:1441424-1441900

>tg1537 Flagella accessory protein C (flaC)
MALTFLSSLFGKKKKEEAATPVEEPIEVEELEETVENREENEQINQLMERINEIENDLPRIKISIDTIKKQIQELRDDID
RLDKTIKDVMMLYEVISQEINPFKEQMGQENPLSNEIQELRKELENLKMELAQVKNDIKVLAGYGVDIDSIIYEVLAEV

>tg1537 Flagella accessory protein C (flaC)
atggcactgactttcctttcatctttatttgggaagaagaaaaaggaggaagcggccacccccgtcgaggagccaataga
ggttgaagaactcgaagagaccgtcgaaaacagggaggagaacgagcagataaaccagctcatggagaggataaacgaaa
tcgagaacgatctcccaaggataaagataagcatcgacaccataaagaagcagatacaggagctcagagatgacatagat
aggctcgacaagaccatcaaggacgtcatgatgctctacgaggtcatcagccaggagataaacccgttcaaggagcagat
gggtcaggaaaatccgctcagcaacgagatacaggagctcagaaaggaactggagaatctcaagatggagctggcccagg
tcaagaacgacatcaaggtgctcgccgggtatggtgtggacatagactcgataatctacgaggtgctggcggaggtg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1440924 - 1442400 (Additional range around tg1537 is :500nt.)

>Thermococcus gammatolerans EJ3 TTAAGGTCATGAACATCTACGGGTACACACCAGCAAACCCACCAAGTGCCGGAAACATAACGAAACTTGTCATCTACGTT ACTCCAAACGCGGGGAGTAGCGGCATAGATCTCAGCTACGTCAAGGTCGTCCTCAGCGACGGCTCCAAGATGACCGTCTT CAAGTATAACCCCAACGCATTTTACACTGGGGACATAGACAACGTATTCACCCTGCCTGTCTGGGTCAACGTAACAGGCA CGAACTTTGGCATAGCAGTGGTTCAGGATTCAGACCTCAGCATAATTAACAACAGAGAGCATCCCGTCCTGAACTGGGGT GATATCGCGGCACTGCTGGTGAACACTACAGGATTTGGCAAGGGTGCTGGATTACCCCCAGCCACCCACGTTACGGGTAA AGTAATACCAGAAAACGGCGCCGCAGGAGTCGTGGACTTCGTAACACCACACGCATACACGGACAAGATACTTACACTGC AGTGAAAGGGGGGTGGCACA atggcactgactttcctttcatctttatttgggaagaagaaaaaggaggaagcggccac ccccgtcgaggagccaatagaggttgaagaactcgaagagaccgtcgaaaacagggaggagaacgagcagataaaccagc tcatggagaggataaacgaaatcgagaacgatctcccaaggataaagataagcatcgacaccataaagaagcagatacag gagctcagagatgacatagataggctcgacaagaccatcaaggacgtcatgatgctctacgaggtcatcagccaggagat aaacccgttcaaggagcagatgggtcaggaaaatccgctcagcaacgagatacaggagctcagaaaggaactggagaatc tcaagatggagctggcccaggtcaagaacgacatcaaggtgctcgccgggtatggtgtggacatagactcgataatctac gaggtgctggcggaggtg TGATGCAATGCAGCTAGCGGGGTTCGTCACTGAGGCCGACATCAACGCCAAGCTCTCAGAG CTTAAAGGCAAGGTGCCAACTGTCGTCATAAACGAACTCAGGGAGAAGCTGATAGCCAGGAAAGATCAGCTCACACCGGA GCAGCTTGACAAGATCGTCAAGAAAGTCCTTGAGACATATGGAAACCAAGCAACAAAGTACGAGCAGTTGAGCAAGCGCG TTGACGAGCTCGGTAAGAGGTTGACTGATTTGAGCCTCCAGCTCAGTAGGCTCGTCGAGAGCCTCGAAGAGGCGAGGTTC AAGGTACAGGAGAAGAAGGCCGAAGAGGTCACCGAGAAAGTGGAAGAGGTTCACGAGAAAATCGGAAAGCTCGAGGAGAT GCTTGAAAGGAAAGAAGAGAAGAAAGAAGAAAAGGAAATCTCAGAGGAGGCAAAGAAGAAGCTCGAAGAGCTTCACAGGA AGGTCGAAGAGCTGGAAGAAAAGCTCAGCGGAAAGGTT