tg1539

Coordinates:1443293-1443817

>tg1539 Archaeal flagellar protein F (flaF)
MGFSVSASAAIIFISFLIAAATLYTAWDNSYNNVQAAQEDWYNRRISQLNTLVSLNASLGSATIDNANGYYNVTFHIQNS
GVTQYLPYWSVVYDGEYRTIYNVSDDNIGFISDYTYLFPSQVAYLNVTRIPLNTEEHSLVITFGNGCWLRLIWHYNGTDV
LLDATPQRGCPTEVS

>tg1539 Archaeal flagellar protein F (flaF)
atgggcttcagcgtttcagcgagtgcagcgataatctttatctcctttttaatcgcggcagcgaccctctacacagcatg
ggacaacagctacaacaacgttcaggcggcgcaggaggattggtacaacaggaggatctcccagttgaatactttagtat
ccctgaacgcgtccctaggatctgcaaccatagacaatgctaacggatactacaacgtaacatttcacatccagaattcg
ggggttactcagtatctgccatattggagcgtagtatacgatggagaataccgcacgatatacaatgttagcgacgataa
cattggtttcatctcggattacacgtatctgtttccatctcaggtggcatatttgaacgtgactaggatccccctaaaca
ccgaggagcactctctggtgataacctttggaaatggttgctggcttagattgatatggcactacaacgggacagatgta
ctgcttgacgcaacccctcaaaggggctgtccaacggaggtgagc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1442793 - 1444317 (Additional range around tg1539 is :500nt.)

>Thermococcus gammatolerans EJ3 GTTGTTGAGGAAGAAAAAGCCGAAGAAGGTGGTGTTGAGATGGCAGAAGGAAAAGTTCAGATTCCCGAGGATATTGCGAA CCTTCTCTTCGAGGAGGAGCCAAGGAAGGCCAGGCTCGAGAAGCTCCCGGAGGACGTCGTGTCAACGATGATAGCCCTCA AGTGGCTCGGATTCCTCATCGACAGGGTCGGCATACAGAACCTGGAGAGGGTCCTCGAGTTCTACTACGAGATCGGCTGG ATCAGCGAGGAAGTGCTCAACCAGCTGCTCCGCTACGCCAAGGGCACTAGGCCGCACCACCGGGACCCCGAGTGGAAGCC GGCTGACAAGCTGACCGTCCAGGACCACCTGATAAGCCTGCTCTTCATAGAGAGGCTTAGGGGGCTGAGGATCAACAGGG ACGTCCTCGACAAGCTTGAGAGGGAGATAAAGCTCCTGGAGAAGACGCTGGACGAGTTTTACGGCATCTGACCAGGGATA GCAGAGCGGGGGAGGGTACA atgggcttcagcgtttcagcgagtgcagcgataatctttatctcctttttaatcgcggc agcgaccctctacacagcatgggacaacagctacaacaacgttcaggcggcgcaggaggattggtacaacaggaggatct cccagttgaatactttagtatccctgaacgcgtccctaggatctgcaaccatagacaatgctaacggatactacaacgta acatttcacatccagaattcgggggttactcagtatctgccatattggagcgtagtatacgatggagaataccgcacgat atacaatgttagcgacgataacattggtttcatctcggattacacgtatctgtttccatctcaggtggcatatttgaacg tgactaggatccccctaaacaccgaggagcactctctggtgataacctttggaaatggttgctggcttagattgatatgg cactacaacgggacagatgtactgcttgacgcaacccctcaaaggggctgtccaacggaggtgagc TGATGGGGGCAGG AGGACCAGCGAGCGAGCTCATAATGTTTATCGTGGCCGTCATAGTGGCCGGTACAGTAGCGGGGGCCCTTACGTATGTCA CCAATGACATAGCCCATGGTATAAACGATAAGGGCTCACTGCTTGCCGATAAACTCAGAACGGACTTTGCGATAATCAAT GATCCACTTAATATCCCAAACTCAACGAGCACCAACCAGTACAATTACACATTTTACATTAAGAATACAGGAAAGACTCA GTTCCCGTTTAACCCCAACGCAGTTCAGGTGTTCATTGATGGTGATATTGTTCCACCCTCAAATCTTACGTTTACAGACA TCAACAACAACACGATCACGTACCTTAATCCCTACGAGGTTGGAAAGATAGTAGTCTCGTTAAGTGGCCCACTTACTAAG GGTAGCCACAGAATAGTAGTTGTCCTCGAGAACGGCGAGAGAAGATCGTTGATCTTCAAAATCTGAGCCCGTAGCCTAAA ATCAGC