tg1548

Coordinates:1452238-1453173

>tg1548 FKBP-type peptidyl-prolyl cis-trans isomerase (slyD)
MVKVEKGDVIRLRYTGRIKETGEIFDTTDEEIAKQAGIYKESGVYGPVPIAVGAGHVIKGLDEQLEGLEVGKKYEIIVPP
EKGFGKRDPKLIKVFTLGQFRRQGIIPFPGMPIEIESEGGRKIKGRVLTVSGGRVRVDFNHPYAGKHLIYEVEIVEKVED
PIEKVKAMIELRLPRIDTNKVVIEVGEKDVTINFTPVLEEIDKNTLVLGEILLESDLKFIGYEDVTFKPNVEELLKPPEE
AAEENVEEKVEEQEETEEAGPAETVQEEKTESDETGEVKEETENKAEPTEEIVEETKAEEATSPEDDEKTGQ

>tg1548 FKBP-type peptidyl-prolyl cis-trans isomerase (slyD)
atggtcaaggttgagaagggagatgtcataaggctccgctacaccggaaggattaaggaaacgggtgaaatttttgatac
taccgacgaggaaatagccaagcaggccggcatttacaaggagagcggtgtttacggccccgtcccgatagccgttgggg
cgggtcacgtcataaagggccttgatgagcagcttgaaggtcttgaggtcggcaagaagtatgaaattattgttccgccc
gagaagggctttggaaagcgtgatccaaagcttataaaggtctttacgctgggccagtttagaagacagggcataattcc
cttcccgggaatgcctattgagattgagagtgaaggtggaaggaagatcaagggaagggttttgaccgttagcggaggcc
gtgtcagggttgatttcaaccacccgtacgctggcaaacacctgatctacgaggtcgagatcgttgagaaggtcgaggat
ccaatagaaaaagtcaaagccatgatagagctccgcctgccgaggattgacaccaataaagtggtcatcgaggtcggcga
gaaggatgtcacgataaacttcacacccgtccttgaggagattgataaaaacactctcgtcctcggcgagatactccttg
agagcgacctgaagttcatcggttacgaagatgtaacctttaagccgaacgtcgaggagcttctcaagcctccggaggaa
gccgccgaggaaaacgttgaagagaaggttgaggagcaggaggagactgaagaggccgggcccgctgagaccgtccaaga
ggagaagaccgagagcgatgagaccggtgaagtcaaagaagagaccgaaaataaggcagagcccaccgaagagatcgttg
aggagaccaaagcggaagaagcaacctcacctgaggatgacgagaagacggggcag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1451738 - 1453673 (Additional range around tg1548 is :500nt.)

>Thermococcus gammatolerans EJ3 TGGAGCTTCTTGATGAAGCTGATGATATCCTGCATGTGCTCGGTGACGCGCGGGTATATATCGGCCGGCTTGACCTTCAG GGCCTTCATATCCTCAAGGAAAATCCTCAGGAATTTCTCCGCCAGTTCTTTCGGGTCTTCCCCGGTCTCGTTGGCGCGTT TGATGATTTTATCGTCTATGTCCGTGAAGTTCATCACCATGAGAACCGTGTATCCCTTGTGCTCAAGGTAGCGCCTTATG ACGTCGAAGGCGATGTAAGTTCTCGCGTGGCCGAGGTGCGGGTAATCATAAACCGTCGGGCCGCAGACGTACATTCTAAC CTCGCCTTCGTGAAGGGGCTTGAACTCCTCCTTCTGCCTCGTGAGGGTGTTGTATATCCTAATCGCCATTCCCACCACCG GGGCCTTTTGGGAGGGCCTTTTTATTAGCTTATCGTTGCGGGAAAGCTTAAAAAGCGACCCCCCAACACCCAGTAGAGCT GGGAAAGGAGGTAGCAGTC atggtcaaggttgagaagggagatgtcataaggctccgctacaccggaaggattaaggaa acgggtgaaatttttgatactaccgacgaggaaatagccaagcaggccggcatttacaaggagagcggtgtttacggccc cgtcccgatagccgttggggcgggtcacgtcataaagggccttgatgagcagcttgaaggtcttgaggtcggcaagaagt atgaaattattgttccgcccgagaagggctttggaaagcgtgatccaaagcttataaaggtctttacgctgggccagttt agaagacagggcataattcccttcccgggaatgcctattgagattgagagtgaaggtggaaggaagatcaagggaagggt tttgaccgttagcggaggccgtgtcagggttgatttcaaccacccgtacgctggcaaacacctgatctacgaggtcgaga tcgttgagaaggtcgaggatccaatagaaaaagtcaaagccatgatagagctccgcctgccgaggattgacaccaataaa gtggtcatcgaggtcggcgagaaggatgtcacgataaacttcacacccgtccttgaggagattgataaaaacactctcgt cctcggcgagatactccttgagagcgacctgaagttcatcggttacgaagatgtaacctttaagccgaacgtcgaggagc ttctcaagcctccggaggaagccgccgaggaaaacgttgaagagaaggttgaggagcaggaggagactgaagaggccggg cccgctgagaccgtccaagaggagaagaccgagagcgatgagaccggtgaagtcaaagaagagaccgaaaataaggcaga gcccaccgaagagatcgttgaggagaccaaagcggaagaagcaacctcacctgaggatgacgagaagacggggcag TGA GCTTTTCTCTCCTGCTTTTTCTTACGGTTTCGCCGAGAGGTTTATAATTTCAGTCGTTGGAGTACTATTCTGGTGAGAGT ATGGCCGTGACAAGGGAGCGCTTTGAGTTGCTGATCAGAGATCTCGTCGGCAGGTTTTCACAGGCTGACGAGAGGAAGAT TAGAGAAGCCCTTAATGCTTTTGTAAAGGTGACCGAGATACCCGTCTCGTATCTCAATCCCGGCTCCCGCTATCATCCTG TGGTTGTCTTCAAAAAGAGGTTTGGAAACCTCGAGAAGAGTGTTATGGTGTCCCTCCTTGAGTTCAGGATCCTCAACCGC TACAACATGCCCGGCTGGAGGCGAGAGGTTGAGTTCAGACTTGACAGAGACGTTGTGCTGAGGGAGCGGGTGGGAGGAAT AGAGGCTGTTCTCATCGGCGATCCGGCCCGGTTGGCCCGGTTGAGGGATGTAATGAGACGCATCCTCCAGCAGATGAGCA CGAGACCGAGGAACTTT