tg1552

Coordinates:1459293-1459565

>tg1552 DNA-binding protein Alba (albA)
MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVTVKARGRAISRAVDVAEIVRNRFLPEVRVKEIKIGTEELPTADGRTAN
TSTIEIVLEKP

>tg1552 DNA-binding protein Alba (albA)
atggctgaggagcacgtcgtctacatcggaaagaagccggttatgaactacgtcctggccgttataacccagttcaacga
gggtgccaaggaggtcaccgtcaaggctcgtggtagggctatcagcagggccgttgacgtcgccgagatcgtcaggaaca
ggttcctcccagaggtcagggtcaaggagatcaagatcggcaccgaggaacttccgactgccgacggcaggaccgccaac
acctcgaccatcgagatcgttctcgagaagccg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1458793 - 1460065 (Additional range around tg1552 is :500nt.)

>Thermococcus gammatolerans EJ3 GGAGGTCGCGCCGAGGTGGACGTACTTCCCGTGCTCACCGCAGACCTCGCTCAATGCCTTTACAACGGCCATTATGTCGT GGTGTATCTCGGCCTCTATCTCCTTGACGCGCTCGGGCTTTACCCACTTTGTATTGGCCCTTTCAGAAATCACGCGAGCA CTCTCCTCAGGGATGTTGCCGAGTTTCGCGTGGGCCCTTGCTAGGGCAGCCTCAACGTCAAGAAGTTTTTGGAGCTTGTT CTCCTCGTCCCAGATTTTTCTCATTTCCTCGCTCCCGTAGCGATAATCAATTGGATGAACTGCCATCCTAATCACCATTT CAATGATTATTCAGTATGTTAAAACGTTTTCTTTTGGCATTATAGTGTCAACGATATTCACGATAATGGACAATTTTGAG ATTGACTCGACCATTGGGGAGACCGGAATGAGGAGAACCGAAAAGTATTTAACCCTATGCCCGCGATAGGCTAACGACAA AACTTCCGGAGGTGCCAGAA atggctgaggagcacgtcgtctacatcggaaagaagccggttatgaactacgtcctggc cgttataacccagttcaacgagggtgccaaggaggtcaccgtcaaggctcgtggtagggctatcagcagggccgttgacg tcgccgagatcgtcaggaacaggttcctcccagaggtcagggtcaaggagatcaagatcggcaccgaggaacttccgact gccgacggcaggaccgccaacacctcgaccatcgagatcgttctcgagaagccg TGAATTGATTAAATCCCTTTCCTTT TACTCTCACCCTTAGCTCCAAACTCTTTTGAAGTCGTGGAAAGGTTTAATACCCCGCCCCCCAAGTTATTAAGGGGGAAT CGTGTGGGCGAGGGGAAGATCATAGAGATTAACGATGAAACCGCAAAGCTTCTGGCCCAGATTATAACGAACGAGAAGGC CCTGGCGATTCTTCATGCCGTTGAGGAGGAGCCTAAATCCCTGACTCAAATCGCTGAGGAACTGGGATTTCCCCTTTCCA CGGTGAGTTATCATATAGATAGAATGCTGAGGGTTGGCCTTGTGGAAGTGGCCGGAAAGAAGTACGGCAAGAAACTTCAG GAGGTCAAACTCTACAGGGCCTCTAACAAGCCAATCCTGATCGTGCCGAGAAGAGAGGCTCCGAAGGTCACGAAGAAGTT GTCCGCCTTCGAGAAACTGCACGTGATAAGCCTCAGCATTGCCTCGATAGTCTCGCTCCTCGTTTACAAGGTTC