tg1553

Coordinates:1459626-1460363

>tg1553 Transcription regulator, ArsR family
MERFNTPPPKLLRGNRVGEGKIIEINDETAKLLAQIITNEKALAILHAVEEEPKSLTQIAEELGFPLSTVSYHIDRMLRV
GLVEVAGKKYGKKLQEVKLYRASNKPILIVPRREAPKVTKKLSAFEKLHVISLSIASIVSLLVYKVLERFARPGVVRTVF
VNNTSTSALEVVRSNSTTSTAEKFIPGSVSSVTSNTTNNTTILPTTAPVKNVTHNAQGDTLVLLGTVLTFAVVFAVTYLL
LRRKRF

>tg1553 Transcription regulator, ArsR family
gtggaaaggtttaataccccgccccccaagttattaagggggaatcgtgtgggcgaggggaagatcatagagattaacga
tgaaaccgcaaagcttctggcccagattataacgaacgagaaggccctggcgattcttcatgccgttgaggaggagccta
aatccctgactcaaatcgctgaggaactgggatttcccctttccacggtgagttatcatatagatagaatgctgagggtt
ggccttgtggaagtggccggaaagaagtacggcaagaaacttcaggaggtcaaactctacagggcctctaacaagccaat
cctgatcgtgccgagaagagaggctccgaaggtcacgaagaagttgtccgccttcgagaaactgcacgtgataagcctca
gcattgcctcgatagtctcgctcctcgtttacaaggttctcgagaggtttgcgagacccggggtcgttagaactgttttt
gtgaacaatacttcaacttctgctctggaggtcgttagatcgaactccacaacgtccactgccgagaagttcattcctgg
ttcggtttctagtgttacctcaaatacaacgaataacacaacgatcctccccaccacagcccccgtgaaaaatgtcacgc
acaacgcacaaggggacactctggtcttgcttgggactgttctaacgtttgcggtggtctttgccgtgacgtaccttctc
ctgaggaggaaacgtttt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1459126 - 1460863 (Additional range around tg1553 is :500nt.)

>Thermococcus gammatolerans EJ3 GTATGTTAAAACGTTTTCTTTTGGCATTATAGTGTCAACGATATTCACGATAATGGACAATTTTGAGATTGACTCGACCA TTGGGGAGACCGGAATGAGGAGAACCGAAAAGTATTTAACCCTATGCCCGCGATAGGCTAACGACAAAACTTCCGGAGGT GCCAGAAATGGCTGAGGAGCACGTCGTCTACATCGGAAAGAAGCCGGTTATGAACTACGTCCTGGCCGTTATAACCCAGT TCAACGAGGGTGCCAAGGAGGTCACCGTCAAGGCTCGTGGTAGGGCTATCAGCAGGGCCGTTGACGTCGCCGAGATCGTC AGGAACAGGTTCCTCCCAGAGGTCAGGGTCAAGGAGATCAAGATCGGCACCGAGGAACTTCCGACTGCCGACGGCAGGAC CGCCAACACCTCGACCATCGAGATCGTTCTCGAGAAGCCGTGAATTGATTAAATCCCTTTCCTTTTACTCTCACCCTTAG CTCCAAACTCTTTTGAAGTC gtggaaaggtttaataccccgccccccaagttattaagggggaatcgtgtgggcgaggg gaagatcatagagattaacgatgaaaccgcaaagcttctggcccagattataacgaacgagaaggccctggcgattcttc atgccgttgaggaggagcctaaatccctgactcaaatcgctgaggaactgggatttcccctttccacggtgagttatcat atagatagaatgctgagggttggccttgtggaagtggccggaaagaagtacggcaagaaacttcaggaggtcaaactcta cagggcctctaacaagccaatcctgatcgtgccgagaagagaggctccgaaggtcacgaagaagttgtccgccttcgaga aactgcacgtgataagcctcagcattgcctcgatagtctcgctcctcgtttacaaggttctcgagaggtttgcgagaccc ggggtcgttagaactgtttttgtgaacaatacttcaacttctgctctggaggtcgttagatcgaactccacaacgtccac tgccgagaagttcattcctggttcggtttctagtgttacctcaaatacaacgaataacacaacgatcctccccaccacag cccccgtgaaaaatgtcacgcacaacgcacaaggggacactctggtcttgcttgggactgttctaacgtttgcggtggtc tttgccgtgacgtaccttctcctgaggaggaaacgtttt TAAGAGTGTGGCCCAACTCCCTCCGAAGGGGTGATAGAGT TGGCAGGGATCAGCGTAGGTCAGATCGTCAAGAGAAAGGCCATCATTGTAAAGCCTGACGACACCGTACACAAAGTCGCC AAGATCCTCGCCCGAAACAGGGTGGGGAGCGCGGTGGTCGTGGAGAACGATGAGATAGTTGGGGTGGTCACGGATCGTGA CATCCTGGATAAGGTTGTCGCAAAGGGAAAGGATCCAAAGAAGGTCAAGGTCAGGGACATAATGACTCAGAACCCGGTAA CGATTGAGGATGACTACAGCATCTCGGACGCGATAGACAGAATGATGGAGAAGGGCATCAGAAGACTCCTAGTTACAAGA CTTGGAAGGCCAATAGGCTTTGTAACCGCCGCTGACCTGTTGGCGGCCCTCAACAGTATGAACAGCGAGGAAGAGGAAGA AACCATCGAGGAGACTGATGTTTACGGCATCTGCGAGCTCTGCGGTCAGTACGGGCCCC