tg1578

Coordinates:1488926-1489960

>tg1578 Acetyltransferase, GNAT family
MEIVRLTEKHLPDFQGLYIEFFKELRGKQGWSPHAEAEYRAEATYYFKRDDIIFLALENGEAAGFIRVSSRDGSFWVEEL
FVRPEFRGRGIGRALVERAEEEVLKWDSALYLFVLPQDKDAIAFWKRLGYDTINTVELVKDLEPTPRDSGFHTVELLGER
FKIFRWKGEKFSEDEKRFMELLEEFYRRGGTKEEFLWTVNTALEKWLTGVEECKKALERVGIETEVTPAELWDYLNARTY
ENDVYEPGEILSNDYLVIHEVREIECLKARGLEITPNVIIENPKETYECHLIALEAELQRAGKEGNAKWIKKRCRDVEEY
LRDENLPENLKGRVVAILERFCTVS

>tg1578 Acetyltransferase, GNAT family
ATGGAGATAGTTCGCCTAACCGAAAAACATCTTCCAGACTTCCAAGGGCTTTACATCGAGTTTTTCAAGGAGCTCAGGGG
GAAGCAGGGCTGGAGTCCACACGCTGAGGCAGAGTACCGGGCCGAGGCGACGTATTACTTTAAAAGGGACGACATAATCT
TCCTTGCCCTTGAAAACGGAGAGGCTGCTGGTTTCATCAGGGTTTCGAGCAGGGATGGAAGTTTCTGGGTGGAAGAGCTC
TTCGTAAGGCCAGAGTTCAGGGGAAGGGGCATCGGAAGGGCTCTCGTTGAGAGGGCCGAGGAGGAGGTTCTGAAGTGGGA
TTCGGCTCTTTACCTCTTCGTCCTGCCACAGGATAAGGACGCCATAGCTTTCTGGAAGAGACTCGGCTACGATACGATAA
ACACTGTCGAGCTCGTGAAGGATCTTGAGCCAACGCCCAGAGATAGCGGCTTTCACACCGTCGAGCTCCTTGGAGAACGC
TTTAAAATCTTCCGCTGGAAGGGGGAGAAGTTCAGTGAGGATGAGAAGCGCTTCATGGAACTGCTCGAGGAGTTTTACCG
GAGGGGCGGGACGAAGGAGGAGTTTCTCTGGACAGTAAACACGGCCCTTGAAAAATGGCTGACGGGGGTTGAGGAGTGCA
AGAAAGCCCTGGAAAGGGTGGGAATAGAAACAGAGGTAACTCCCGCTGAGCTGTGGGATTATCTGAACGCGAGAACATAT
GAAAACGATGTTTATGAGCCCGGGGAGATACTCTCCAACGACTACCTCGTGATTCACGAGGTCAGGGAAATTGAATGCCT
CAAAGCCAGAGGCCTTGAGATAACGCCGAACGTGATAATCGAGAACCCAAAAGAGACGTACGAGTGCCACCTCATAGCTC
TTGAGGCGGAACTCCAGCGTGCTGGAAAAGAGGGTAATGCTAAATGGATTAAAAAACGCTGCCGTGATGTTGAAGAGTAC
CTCCGAGACGAGAACTTGCCTGAGAATCTGAAGGGACGAGTTGTAGCAATACTTGAGAGGTTCTGCACTGTATCC


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1488426 - 1490460 (Additional range around tg1578 is :500nt.)

>Thermococcus gammatolerans EJ3 GCGACCTACTTCCTCAGCCGCGAGAGCATAGCCATGGCAAAGAGAGACGGCTTCTCGATAACCGCGAAGTTCTTCAACCT GGGGGCGAAGGTTTCCGCCTTCGAGCCCGAGGAGCCAGCGATGGTAGAGCCCAGCCTAGAAGACCTGACCCTCGGCGTAA TTCCCGCCGGATTGAAGTTTCTCCGCAGGAGTCATGAGAGCCTCGAATGGCTGAAGGCGAAGGCCGAATTCTACGACATC AACGGCTTCCGCTTCCTCGTTCCGAAGGGGGAGGCAACGTTCACGCCCCTCGACGTTGGACTGGCAACTCTCAAGGCGAT GCTTCCCGCTATGGCTTGGGTCGCCCGCGAGAGGGGATGGGAGGAGTTCGAGGTGATGCTCCCGAGCGGTGTTAAGCCCC TCCTGCCGGGACTGAGGAGGCTTGGTCTCTTCCTATGGGAGGAGACTGAGGAGCCTAACGTGCTGGTGTTCCGGAAGAGG CTCGTGTGGGGCTGAATGC ATGGAGATAGTTCGCCTAACCGAAAAACATCTTCCAGACTTCCAAGGGCTTTACATCGAG TTTTTCAAGGAGCTCAGGGGGAAGCAGGGCTGGAGTCCACACGCTGAGGCAGAGTACCGGGCCGAGGCGACGTATTACTT TAAAAGGGACGACATAATCTTCCTTGCCCTTGAAAACGGAGAGGCTGCTGGTTTCATCAGGGTTTCGAGCAGGGATGGAA GTTTCTGGGTGGAAGAGCTCTTCGTAAGGCCAGAGTTCAGGGGAAGGGGCATCGGAAGGGCTCTCGTTGAGAGGGCCGAG GAGGAGGTTCTGAAGTGGGATTCGGCTCTTTACCTCTTCGTCCTGCCACAGGATAAGGACGCCATAGCTTTCTGGAAGAG ACTCGGCTACGATACGATAAACACTGTCGAGCTCGTGAAGGATCTTGAGCCAACGCCCAGAGATAGCGGCTTTCACACCG TCGAGCTCCTTGGAGAACGCTTTAAAATCTTCCGCTGGAAGGGGGAGAAGTTCAGTGAGGATGAGAAGCGCTTCATGGAA CTGCTCGAGGAGTTTTACCGGAGGGGCGGGACGAAGGAGGAGTTTCTCTGGACAGTAAACACGGCCCTTGAAAAATGGCT GACGGGGGTTGAGGAGTGCAAGAAAGCCCTGGAAAGGGTGGGAATAGAAACAGAGGTAACTCCCGCTGAGCTGTGGGATT ATCTGAACGCGAGAACATATGAAAACGATGTTTATGAGCCCGGGGAGATACTCTCCAACGACTACCTCGTGATTCACGAG GTCAGGGAAATTGAATGCCTCAAAGCCAGAGGCCTTGAGATAACGCCGAACGTGATAATCGAGAACCCAAAAGAGACGTA CGAGTGCCACCTCATAGCTCTTGAGGCGGAACTCCAGCGTGCTGGAAAAGAGGGTAATGCTAAATGGATTAAAAAACGCT GCCGTGATGTTGAAGAGTACCTCCGAGACGAGAACTTGCCTGAGAATCTGAAGGGACGAGTTGTAGCAATACTTGAGAGG TTCTGCACTGTATCC TGAGACGCTTGGAATGCCGAGGTTTATAAAGGGCGACGTCGAGGGTAAGTTAGGTGAACCAAAT GAAGACCGAGAGAGCGAAGGAAATACTCCTCCAGCTTTTGAAGATACCCTCGCCTTCGGGCCAGGAAGACAGGATAATGC TCCACATCATGGAGTTCCTCCATAAGCTCGACTACGACGTCCACATCGAGAGCGACGGCGAGATAATAGACCTCGTCGTG AACCCTGAGGCGGAGCTCTTCTACGAGGTCCACGTGGACACGATACCGATTCGCGCTGAGCCCTTCGTCAGGGGCAACAT AATCTACGGCACCGGCGCGAGCGACATAAAGGGCGGCGCCGCGGCAATACTCCTCATGCTTGAGAGCCTGAAGAGGGAAA ACAAGGACCTCAACGTCGGTATCGTCTTCGTCAGCGACGAGGAGCTCGGCGGTCGCGGGAGCGCGCTCTTTATGGAGCGT TACCGGCCCAAGATGGCCGTCGTTCTGGAACCGACC