tg1584

Coordinates:1494006-1494509

>tg1584 hypothetical protein TGAM_1584
MVDMVDEKGGTPKKLEELLNEIVEEMRNARSEEELEVLRKKADILEDLIEAYEGDKDLEKIPLLMEKVGEMVEDILQPLK
ELLNELYSPERVQAMGKSVAEFYKSLVEAGMDKEAALELTKEYMDSINPGKKLMEMLGGLMKGHGGRFQIPGFPHGRGGE
RKTDGEGE

>tg1584 hypothetical protein TGAM_1584
gtggttgacatggtggatgaaaagggtggaactccgaagaagctggaggaactcctaaatgagattgtagaagagatgag
gaacgccaggagcgaggaggagctcgaagtcctcaggaagaaggcggacatactggaggacctcatagaggcctacgagg
gtgacaaggatttggagaagatacccctcctcatggagaaggtcggcgaaatggtggaggacatccttcagccactcaaa
gagctcctcaacgagctctacagccctgagagggttcaggcgatgggaaagagcgtggcggagttttataagagcctcgt
cgaggcgggcatggacaaagaggcggcgcttgagcttaccaaggagtacatggactcgataaaccccggcaagaagctca
tggagatgctcggcggccttatgaaggggcacggcggaaggttccagattccaggatttcctcatggacgtggaggagag
agaaagaccgacggggagggcgaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1493506 - 1495009 (Additional range around tg1584 is :500nt.)

>Thermococcus gammatolerans EJ3 CCCAGTTAATTGCTCACTCCTGACCGGAAACGCTAAAGGGTTGATCACCCAACCATTAACCATGCCCGACGAGGAGCTCG CAAGGGAAGTGCAGGAGCTCAGGAAGGCGCTCGAAGAGCTCAGGGAGAGCTTCGCCCTCGTTTCCCAGCTGGCGCAGGCT TACCTTCGGCTCATCAATCTATACGCCCAGTACGGTAGCCTGGGAATAGAGGTAGCCGTTCCCGAAGTCACCGATCCCAT ATCGAGGGAAATCGTCCGGATTCTCTTCGACCTCAAGCGGGCCAACGTGAGCCAGATAGCGCGGGAGCTGAAGGGTAGGC GCGGAAAGGCTTCCCGCAACACGGTTCGAGCGAAGCTGGCCGAGCTGAAGGAGATGGGCATCGTCGTTGAGATTCCCGGC GAGCGGGGAAAATGCTACGCCCTCTCAAAGAGGGTGGTCAAAAAGTGGCTCGAAATAATCGGAATCCCGATTAAGCTTGA CCGGACTAATGATTATCGGG gtggttgacatggtggatgaaaagggtggaactccgaagaagctggaggaactcctaaa tgagattgtagaagagatgaggaacgccaggagcgaggaggagctcgaagtcctcaggaagaaggcggacatactggagg acctcatagaggcctacgagggtgacaaggatttggagaagatacccctcctcatggagaaggtcggcgaaatggtggag gacatccttcagccactcaaagagctcctcaacgagctctacagccctgagagggttcaggcgatgggaaagagcgtggc ggagttttataagagcctcgtcgaggcgggcatggacaaagaggcggcgcttgagcttaccaaggagtacatggactcga taaaccccggcaagaagctcatggagatgctcggcggccttatgaaggggcacggcggaaggttccagattccaggattt cctcatggacgtggaggagagagaaagaccgacggggagggcgaa TGAACCCGCTCCCAATTTTTCGCTTTTTTCTCCG CCTTCCATCGCTCGCGTTTAGAATTGCCGGTCTTGTGAGGATAACCAACCGGGCGAGGAGGAGCTTTAAAAAAGTCCTCA GGAAGGAAGGCCTGCCCGAAGACGTCGCTGAGGAGCTTGAAAGGCATTTCACTCCTCGGTTTCCTTCTCTTCTCAAGCGG TAACCAATTCTTCAAGATTTTCAATGGGGTTACCTGGTTCATAGATGTCCCGATTGAGCAGGCCATTGCCCTCTTTAGTC AACTTGCCTCGAAGTTTCTTCAGTTCCCCACATGGCCATAACGGTCGCTTTTACCGCGCTCTCGTTCCCGTAGAGGAGCA TCACCCTGTCCATACCCGGCCCGTTGTACAGCTCAATGTACACACTTCCATTGCCCTCAAAGTAGGCCCGCTGGACGATC TCCCCCGCCGGATCCCGGGATTTCAGGGGTGGAAGGGGTTTCTCCCGAAAGTCCAGCCCCTTGAT