tg1596

Coordinates:1503648-1504286

>tg1596 3-dehydroquinate dehydratase (aroD)
MIAGVVVARNAREAVAKIREGNADLYEVRLDRFESFELAPLKPFADRLIITIRRAEEGGFRRIPEEERLELYRRAMTLKP
RYVDVEARSEIAGEVMREARKRRVGVILSHHDFEGTPPFETLMEILQGMASMAPDVVKIVPTANSHLDNVRVLRLYEHAE
NLVAFCMGPLGRISRLFSALLAPFTYASLEKAVAPGQMSVEELRQLLVMLDGR

>tg1596 3-dehydroquinate dehydratase (aroD)
atgatagccggcgtggtggtggcgaggaacgcccgcgaggctgtggcgaagataagggaaggcaatgccgacctctacga
ggtaaggctggaccgcttcgagtccttcgagctcgccccgctcaagcccttcgccgacaggctgataatcaccatcagaa
gggccgaggagggaggtttcagaaggattcccgaggaggagaggcttgagctctacaggagggcaatgacccttaagcca
aggtacgttgacgtcgaggcccgctctgaaatagcgggcgaggtgatgagggaggccagaaagagaagagtgggcgtcat
actttcccaccacgacttcgaggggacaccgccattcgagaccctgatggaaatccttcaaggtatggcgagcatggccc
cagatgttgtcaagatagtgccgacggcaaactcccacctcgacaacgtgagggttctcaggctttacgagcacgccgag
aacctcgtggccttctgcatggggcctctggggaggatatccaggctcttcagcgcgctcctcgcccccttcacctatgc
atcccttgagaaagctgtcgccccgggtcagatgagcgttgaggagctcagacaactgctggtgatgctggatggacgc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1503148 - 1504786 (Additional range around tg1596 is :500nt.)

>Thermococcus gammatolerans EJ3 GGATGGCCGAAGTAGTGAAGTACGGAATCCTCGATAGAAAAGTCTACTCCCTCCTGAAAAAGCTCGGCTCCGTTGAGGAC CTCGACAGGGAGCTCGTGAAGGCCTGCGTGGAGGTTAAGCTGAGGGTAGTTGAGGAGGACCTCAGGGAGGGCGGTAAGAG GCGCATCCTGAACCTCGGGCACACAACAGCCCATGCGATAGAGAAGCTCTCTAACTACACGATAAAGCACGGCTTCGCGG TCGCTGTTGGTTTGATGGTTGCGGCCAAGCTCGGCGAGATTCTCTACAACTTCGACCCCGGAAAGGTTGAGGAACTCCTC AGGAAGTTCGAACTGCCGACGGGGCTTCCCTTTGAGCCCGAGAAAATCCTCGGGGAGATGAGGCTCGACAAGAAGGCGTG GTACGGCAGGCTGACCTTCGTCGTTCCCATCGAGGTCGGCGAGGTTACCATCGAGGAAGTCGAGGAAGACGTCGTGAGAA GGGCGCTGGAGGCGGTTGG atgatagccggcgtggtggtggcgaggaacgcccgcgaggctgtggcgaagataagggaa ggcaatgccgacctctacgaggtaaggctggaccgcttcgagtccttcgagctcgccccgctcaagcccttcgccgacag gctgataatcaccatcagaagggccgaggagggaggtttcagaaggattcccgaggaggagaggcttgagctctacagga gggcaatgacccttaagccaaggtacgttgacgtcgaggcccgctctgaaatagcgggcgaggtgatgagggaggccaga aagagaagagtgggcgtcatactttcccaccacgacttcgaggggacaccgccattcgagaccctgatggaaatccttca aggtatggcgagcatggccccagatgttgtcaagatagtgccgacggcaaactcccacctcgacaacgtgagggttctca ggctttacgagcacgccgagaacctcgtggccttctgcatggggcctctggggaggatatccaggctcttcagcgcgctc ctcgcccccttcacctatgcatcccttgagaaagctgtcgccccgggtcagatgagcgttgaggagctcagacaactgct ggtgatgctggatggacgc TGAGACGAGGCTTTACGGCCTTATCGGCTTCCCGGCCAGGCACTCGCTAAGCCCTGCGAT GCACAACGCGGCCTTTCGGGAGCTCGGGATGAACGCGGTCTACCTCGCCTTCGAGGTGGCCCCTGAACGGCTCAAGATGG CTGTTGATGGTGTCAGGGGACTGGGAATACATGGCCTGAACGTCACGATGCCCCACAAGACGACCGTCATAGAGCACCTC GACGGGCTCTCCGGGGAAGCCGAGGAGATAGGGAGCGTGAACACGATAGTCAACGACGGCGAGCTGATTGGATATAACAC CGATGGCGTAGGCGCGAGGAGAGCCCTTGAGATGGTGACGAGCCTTAGGGGAAAGAACGTCCTCATCATTGGAGCCGGAG GCGCCGGGAGGGCGATAGCCTACGCGCTCTCAAAGGTTTCAGAGGTTGTAGTCCTCAACAGAACGCCGGAGAAAGCCAGG GCCTTGGAGCGCTTCGGGGTTACTGGGGACAGACTAACGC