tg1599

Coordinates:1506046-1506960

>tg1599 Transketolase C-terminal section (tk)
MIESFREAFGRALVELGKENEKIVVVDADVKSSTKTVYFERAFPERFVQVGISEQDMVSTAAGLAIAGKIPVVSAFAAFL
MRAWEQIRNTVARDNLNVKLIPTHSGFSDHMDGSSHQCLEDIALMRVLPNMTVVVPADAPSVPVLLKEVVEHEGPVYMRL
GRDHAPRVYERPELELGRASVLREGSDVLLVANGVMVSVALEVAKALEERNVEAGVIDMHTVKPLDEKTLVRMARKVNTV
ITMEEHSVYGGLGGAVAEVLSERLPRRVIRIGTTDFGRSSRDYFALLKRYGLTADAVVRRIEGVI

>tg1599 Transketolase C-terminal section (tk)
gtgatagagagcttcagggaggcctttggaagggccctggtggagctcgggaaggagaacgaaaagatagtggtcgttga
cgccgatgtgaagagctcaacgaagacggtatacttcgagagggcctttccggagcgctttgttcaagttggaataagcg
agcaggacatggtgtcaacggccgccggcctggcgatagccgggaaaattccggtggtttcggccttcgccgccttcctt
atgagggcgtgggagcagataaggaacaccgtcgccagggacaacctcaacgtcaagctcataccgacgcactcgggttt
ctcagaccacatggacggctcctcccaccagtgcttggaagacatcgccctgatgcgcgtgctgccgaacatgacagtcg
tcgttcccgcggatgccccctcggtgccggtgctgctaaaagaagtcgtagagcacgaggggcccgtttacatgcgcctc
ggcagggaccatgcgccgagggtctacgaaaggccggagctcgagctcggaagggcgagcgtcctcagggaggggagcga
tgtcctgctggtggccaacggcgtcatggtttcggttgccctcgaagtggccaaggccctcgaggagaggaatgttgagg
ccggagtgattgatatgcacaccgtgaagcccctcgacgagaaaaccctcgtcagaatggcgaggaaggtcaacacggta
atcacgatggaggagcacagcgtctacggcggcctcgggggagctgttgcggaagttctctcggagaggctcccgaggag
ggtaataaggataggcaccaccgattttggaaggtcgagcagggactacttcgccctgctgaagcgctacggcctaacgg
ccgatgcagtggtgaggagaattgagggggtgatt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1505546 - 1507460 (Additional range around tg1599 is :500nt.)

>Thermococcus gammatolerans EJ3 CCGCTCCGGCCTTCTACGTTATGCTCCACGAGATGGGCCTTCTGAGCGACGAGGAGCTCTACAGCTTCGCCGACATAGAC GGCCTCCCGAGCCACGTCATGCGCGGGCTTCCCTTCATAGAGGTCTCGAGCGGCTCCCTCGGCCAGGGGCTTTCGGTTGC AAACGGAATAGCCCTCGCGAAGCGCATTGACGGCGAGGAGGGCAGGATATACGTCATTCTCGGCGATGGAGAGCTCGATG AGGGCCAGGTGTGGGAAGCGGCCATGACGGCGGCGCACCACAGGCTTGAGAACGTCATAGCAATCGTGGACAGGAACTAC TTCCAGCTGACGGGAAAGACCGAGGAGATACTCAACAAGGAGCCGATAGCCGAGAAGTGGCGGGCCTTCGGATGGGAGGT CATCGAAGTTCCCAACAGGGAGGAGGAGATAGAGAAGGCCCTGGAGCGGGCTGAGGAAATCAAGGGCAGGCCCAAGGTCG TAATAGTGAGGTGGGAGGG gtgatagagagcttcagggaggcctttggaagggccctggtggagctcgggaaggagaac gaaaagatagtggtcgttgacgccgatgtgaagagctcaacgaagacggtatacttcgagagggcctttccggagcgctt tgttcaagttggaataagcgagcaggacatggtgtcaacggccgccggcctggcgatagccgggaaaattccggtggttt cggccttcgccgccttccttatgagggcgtgggagcagataaggaacaccgtcgccagggacaacctcaacgtcaagctc ataccgacgcactcgggtttctcagaccacatggacggctcctcccaccagtgcttggaagacatcgccctgatgcgcgt gctgccgaacatgacagtcgtcgttcccgcggatgccccctcggtgccggtgctgctaaaagaagtcgtagagcacgagg ggcccgtttacatgcgcctcggcagggaccatgcgccgagggtctacgaaaggccggagctcgagctcggaagggcgagc gtcctcagggaggggagcgatgtcctgctggtggccaacggcgtcatggtttcggttgccctcgaagtggccaaggccct cgaggagaggaatgttgaggccggagtgattgatatgcacaccgtgaagcccctcgacgagaaaaccctcgtcagaatgg cgaggaaggtcaacacggtaatcacgatggaggagcacagcgtctacggcggcctcgggggagctgttgcggaagttctc tcggagaggctcccgaggagggtaataaggataggcaccaccgattttggaaggtcgagcagggactacttcgccctgct gaagcgctacggcctaacggccgatgcagtggtgaggagaattgagggggtgatt TGAGTGAAGTACAGCAAGGAGTAC CGGGATAAAACCGTAGTTAAGGTCGGGGACGTTAAAATAGGCGAGGGCTTCACGATAATGGCCGGCCCCTGCGCCATCGA GAGCGAGGAGATGATAATGAAGGTTGCCGAGTTTCTGGCGGAAAAGGGCGTGAAAGTCCTCAGGGGAGGGGCCTTCAAGC CCAGAACGAGCCCCTACTCCTTCCAGGGGCACGGCGAGGAAGCGCTCAAGTGGCTTAGGAGGGCAGCCGACGAGTACGGG CTCGTTACCGTAACGGAGGTAACCGACACGAGGAAAGTCCCCCTGGTTTCCAGGTACTCCGACATAGTCCAGATAGGCGC GAGGAACTCCCAGAACTTTGAGCTGCTCAAGGAGGTCGGTAAAATAGACAACCCCGTGCTCCTCAAGAGGGGGATGGGCA ACACGGTTCAGGAGCTCCTCTACTCGGCGGAATACGTAATGAGCGAGGGCAACGAGAACGTAATCCTCTGCGAGCG