tg1600

Coordinates:1506960-1507616

>tg1600 Transketolase N-terminal section (tk)
MSEVVKPQGKLMAMLSPVSNFHLESSETCLSILAAVLRRKGEKDVVILSKGHSAPAFYVMLHEMGLLSDEELYSFADIDG
LPSHVMRGLPFIEVSSGSLGQGLSVANGIALAKRIDGEEGRIYVILGDGELDEGQVWEAAMTAAHHRLENVIAIVDRNYF
QLTGKTEEILNKEPIAEKWRAFGWEVIEVPNREEEIEKALERAEEIKGRPKVVIVRWEG

>tg1600 Transketolase N-terminal section (tk)
atgagtgaggtcgtgaagccgcagggcaagctcatggccatgctctcccccgtttcaaacttccatctcgagtcctcgga
gacatgcctgtcaatactcgcggcggtgctcaggaggaagggcgagaaggacgtggtgatactcagcaagggacactccg
ctccggccttctacgttatgctccacgagatgggccttctgagcgacgaggagctctacagcttcgccgacatagacggc
ctcccgagccacgtcatgcgcgggcttcccttcatagaggtctcgagcggctccctcggccaggggctttcggttgcaaa
cggaatagccctcgcgaagcgcattgacggcgaggagggcaggatatacgtcattctcggcgatggagagctcgatgagg
gccaggtgtgggaagcggccatgacggcggcgcaccacaggcttgagaacgtcatagcaatcgtggacaggaactacttc
cagctgacgggaaagaccgaggagatactcaacaaggagccgatagccgagaagtggcgggccttcggatgggaggtcat
cgaagttcccaacagggaggaggagatagagaaggccctggagcgggctgaggaaatcaagggcaggcccaaggtcgtaa
tagtgaggtgggagggg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1506460 - 1508116 (Additional range around tg1600 is :500nt.)

>Thermococcus gammatolerans EJ3 GACTGGAAGATGGTGCTGTTATCGGCTTGTCAAAGTGACAAAAAATTGAGGAATTAGGGGGCAATTTTTGGACAAATTTG GGGCCATATTCCCCCTAACGTTCAATGGACAGCTCAACCTGTCGAAGAATTTAAATAGGACCTACTGTTCCTCAGTTTCG GTGATCGCGATGTCCCGCCTTGGAAGGTCCTCAAACCAGGTGATGCCCCACCAATATTGGTAGGCCCGAGCGGGCCAGCC ATTAGAAAGCTTATTCTGAGGGCTTTGAATGAGAACCAGAGGCTGATACTGAGAAGCATCAACGGCAGACACCGCTCCCT CAACTCGCTTCTCGAAGAGCTGAGCAGGCGCGAAAAGAGGCCACTCTCAACGCTGAAGCTGAACGCGAGGATACTCAAGG AGCTCGGGCTCATAGACTACGGCACGAGGGACGACCCGAGGCCCGTCAGGCTGACGGAAGAAGGGCTGCTCGTTCTCAGG ATTTTGGGGGTGAACGATG atgagtgaggtcgtgaagccgcagggcaagctcatggccatgctctcccccgtttcaaac ttccatctcgagtcctcggagacatgcctgtcaatactcgcggcggtgctcaggaggaagggcgagaaggacgtggtgat actcagcaagggacactccgctccggccttctacgttatgctccacgagatgggccttctgagcgacgaggagctctaca gcttcgccgacatagacggcctcccgagccacgtcatgcgcgggcttcccttcatagaggtctcgagcggctccctcggc caggggctttcggttgcaaacggaatagccctcgcgaagcgcattgacggcgaggagggcaggatatacgtcattctcgg cgatggagagctcgatgagggccaggtgtgggaagcggccatgacggcggcgcaccacaggcttgagaacgtcatagcaa tcgtggacaggaactacttccagctgacgggaaagaccgaggagatactcaacaaggagccgatagccgagaagtggcgg gccttcggatgggaggtcatcgaagttcccaacagggaggaggagatagagaaggccctggagcgggctgaggaaatcaa gggcaggcccaaggtcgtaatagtgaggtgggagggg TGATAGAGAGCTTCAGGGAGGCCTTTGGAAGGGCCCTGGTGG AGCTCGGGAAGGAGAACGAAAAGATAGTGGTCGTTGACGCCGATGTGAAGAGCTCAACGAAGACGGTATACTTCGAGAGG GCCTTTCCGGAGCGCTTTGTTCAAGTTGGAATAAGCGAGCAGGACATGGTGTCAACGGCCGCCGGCCTGGCGATAGCCGG GAAAATTCCGGTGGTTTCGGCCTTCGCCGCCTTCCTTATGAGGGCGTGGGAGCAGATAAGGAACACCGTCGCCAGGGACA ACCTCAACGTCAAGCTCATACCGACGCACTCGGGTTTCTCAGACCACATGGACGGCTCCTCCCACCAGTGCTTGGAAGAC ATCGCCCTGATGCGCGTGCTGCCGAACATGACAGTCGTCGTTCCCGCGGATGCCCCCTCGGTGCCGGTGCTGCTAAAAGA AGTCGTAGAGCACGAGGGGCCCGTTTACATGCGCCTCGGCAGGGACCATGCGCCGAGG