tg1609

Coordinates:1514533-1515066

>tg1609 Imidazoleglycerol-phosphate dehydratase (hisB)
MKRETRETSVEVELDAPFGVETGDRILDHMLTALFHYMGRSARVKADYDLRHHLWEDVGITLGEELRSKLPEKFRRFGSA
ITPMDDALVLIAVDISGRPYVSAELSFEEGEEGFEKALVREFLWGLARSLKATIHVKTLSGTNAHHVIEATFKGLGIALA
QATRESERLESTKGLLEV

>tg1609 Imidazoleglycerol-phosphate dehydratase (hisB)
atgaagcgggaaacgagggaaaccagcgttgaggtagagctcgacgctccgtttggcgttgagaccggcgacagaatact
cgaccacatgctcacggctctgttccactacatgggcaggagcgcgagggttaaagcggactatgacctcaggcaccacc
tctgggaggacgtcggcataacgctcggggaggagctccgctcgaagctccccgagaagttcaggcgctttgggagcgcg
ataaccccgatggacgacgccttggttctaatcgcggtggacatctcagggaggccctacgtgagcgctgagctgagctt
tgaagagggcgaggagggctttgagaaggccttggtcagggagttcctctgggggctggcgcgctcgctgaaagctacta
tccacgtgaaaactctgagcggaacaaacgcgcaccacgtcatcgaggcaaccttcaaggggctcggcatcgcgctggcc
caggcgactcgggagagcgagaggctggagagcacgaagggactgctggaggtg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1514033 - 1515566 (Additional range around tg1609 is :500nt.)

>Thermococcus gammatolerans EJ3 ATAGCGGACGAAACCGCTGATAAGGAATACGTTTTGGCCGATTTGCTCAGCCAGCTGGAGCACGGAAAGGACAGCAAAGC ATGGCTTCTGACGACCTCGGAGGAGCTTGCTCGCTACTGCTCCCGCGATGGGGTGGAGGTGATTCTCTGCGAAAGCCTCG CGGAGTGCGCCAGAAAAGCGAACGAGATAGCCCCGGAGCACCTTGAGATAATCACTGAGAACCCGCTCGATTTGGTTGAC CTCATCGAGAACGCCGGGGCGATATACCTCGGACCCTACACGCCCGTTCCTTCGGCGGATTACTTCCTTGGAGTCAACCA CGTCCTTCCAACGGGGGGAGCGGCGAAGTTCAGCGGGGTTTTAACTGTGATGGACTTCCTCAAGCCGATAACCCTTGCCA TGGTCTCGCGGGAGGAATTCCTGAGGGAGAGGGAGCTCGGATTAAGGCTTGCCGAGATAGAGGGAATGGAGCTCCACAGG AGGAGCATGGAGGTGAGAAA atgaagcgggaaacgagggaaaccagcgttgaggtagagctcgacgctccgtttggcgt tgagaccggcgacagaatactcgaccacatgctcacggctctgttccactacatgggcaggagcgcgagggttaaagcgg actatgacctcaggcaccacctctgggaggacgtcggcataacgctcggggaggagctccgctcgaagctccccgagaag ttcaggcgctttgggagcgcgataaccccgatggacgacgccttggttctaatcgcggtggacatctcagggaggcccta cgtgagcgctgagctgagctttgaagagggcgaggagggctttgagaaggccttggtcagggagttcctctgggggctgg cgcgctcgctgaaagctactatccacgtgaaaactctgagcggaacaaacgcgcaccacgtcatcgaggcaaccttcaag gggctcggcatcgcgctggcccaggcgactcgggagagcgagaggctggagagcacgaagggactgctggaggtg TGAG CGTGATAGCGATAGTTGACCTAGGGGTTGGAAACCTCGCCAACGTGAGGAAGGCCCTTGGCGGAGTAATCACGAGCGACC CCTACGAGATTGAAAGGGCCGAGAAGCTCGTCCTTCCGGGCGTGGGTAACTTTGGAGCTGTGATGGAGAGGCTCGAACCG CTGAGGAGGGTCATACTCGACGCCATAAACGACGGAAAGCCCTTCCTCGGGATATGCCTTGGATTACAGCTCCTCTTCGA GGGGAGCGAGGAGAGTCCCGGAAAGCCCGGCCTCGGCGTGTTTAGGGGGCGGGTTGTAAGGTTTCAGGGAGTTCGAACGC CTCACATCGGCTGGAACCAGCTGTGGAAGCGGAAGGACTGTCCGCTCTTCGAGGGAATCAGGGATGGGGCGTACTTCTAC TTCGTCCACTCCTACTACGCCGAGCCAGAGGAGGACGTCACCGCTGGAGTTACCGACTACGAGTCAAAGGGCAGGAAGGT GGTATTCACCTCGGC