tg1615

Coordinates:1518741-1519463

>tg1615 HAD-superfamily hydrolase, putative
MWVVFDIDGTLIDVGESYDLAVKLTVEYFLRSFGREREVELEWIRKLRSKGSFGDDFKVSEALILFSLAGDVKGLIDQFP
PGEGIGWVRKRFGLEISPENIERVFNTFYLGNIYEDRLFDFPGLWRREKPLIEAELLRKLSEEFKVGVVTGRSELELRLA
EEILGFRFERAVTRELGLKPNPDLLWELVNGERGVYVGDTLNDELFVENYRRKYGDFDFVMVGRDVENVSEFVENMLEGG
K

>tg1615 HAD-superfamily hydrolase, putative
gtgtgggtggtctttgacatcgacgggacgctgatagacgtgggcgagagctacgacttggcggttaaactgacggtgga
gtacttcctcaggtctttcggtagggagcgggaggttgagctcgagtggatacgaaagttgcgctctaaaggtagctttg
gagacgacttcaaggtgagcgaggccctaatactgttctccttagccggggacgttaaaggccttatagaccagttcccc
ccgggggagggcataggctgggttcggaagaggttcggccttgaaatatccccagagaacatagagagggtcttcaacac
cttctacctcggaaacatctacgaggacaggctcttcgactttccgggcctctggaggagggagaaaccgctcatcgagg
ccgagctcttaaggaaactttcagaggagttcaaggttggggtcgtcacaggcaggagcgagcttgagctcaggctggct
gaagaaatcctcggcttccgctttgaaagggccgtaacgagggagctcggtctcaagccgaaccccgacctgctctggga
gctggtgaatggtgaaagaggggtttacgtcggcgatacgcttaacgacgagctcttcgtcgaaaactacaggaggaaat
acggtgactttgacttcgtcatggtcgggcgggacgttgaaaacgtttcggaattcgttgagaacatgctggagggagga
aaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1518241 - 1519963 (Additional range around tg1615 is :500nt.)

>Thermococcus gammatolerans EJ3 AAGGCCAGTTGTTCTCGACGAGGCCTACGCGGAATTCGTGGGAAAAAGCCTCTGGAGGCTCATAGAAGAGTATCCAAACC TAGTAGTGCTGAGGACGTTCTCCAAGGCCTTTGGGATGGCCGGAATCAGGGCCGGCTACATGCTGGCGGGCGAGGAAATC GTCGACGCCCTCTACCGGATAAAATCCCCCTTCAGCGTCGGAATCATGACGATGACGGCCATAAGGGTCGCCCTGAGGCA CGCCGACCTTATGGAGAAAACCGTTAGGAAAATCGTTGAAGAGCGCGAGAGGATGAGGAGAAAGCTCGGGGAGTTAGCCT ATCCAAGCGACGCCAACTTCCTCCTCGTCAGGCTCAATGCCTACGAAGAGCTTTTGAAGAGGGGCATAGTTGTTAGAAAG CTCTCCGGAAGGCTTGAGGGCCACATAAGGGTAACCGTCGGCAGGAGATGGGAGAACGATGCCTTTCTTGAGGCGGTGGA GGAGATAGCAGGTGGTGAAA gtgtgggtggtctttgacatcgacgggacgctgatagacgtgggcgagagctacgactt ggcggttaaactgacggtggagtacttcctcaggtctttcggtagggagcgggaggttgagctcgagtggatacgaaagt tgcgctctaaaggtagctttggagacgacttcaaggtgagcgaggccctaatactgttctccttagccggggacgttaaa ggccttatagaccagttccccccgggggagggcataggctgggttcggaagaggttcggccttgaaatatccccagagaa catagagagggtcttcaacaccttctacctcggaaacatctacgaggacaggctcttcgactttccgggcctctggagga gggagaaaccgctcatcgaggccgagctcttaaggaaactttcagaggagttcaaggttggggtcgtcacaggcaggagc gagcttgagctcaggctggctgaagaaatcctcggcttccgctttgaaagggccgtaacgagggagctcggtctcaagcc gaaccccgacctgctctgggagctggtgaatggtgaaagaggggtttacgtcggcgatacgcttaacgacgagctcttcg tcgaaaactacaggaggaaatacggtgactttgacttcgtcatggtcgggcgggacgttgaaaacgtttcggaattcgtt gagaacatgctggagggaggaaaa TGAGGGTTGCCGTTTTGGGTGCCGGAACGATCGGCGGGGCAATCGCGAAGGCCCT GAAAAAGGCCGGCTACGACGTCGTTGCGACGAGGAGGAGGATTGAGAAGGCCAAAGAGCTCCTCGAACTTGGGATAGAGG TTATTTCGGACAACAGGGAGGCCGTTGAGAAAGCTGACGTCGTTTTCATAGCTGTGAAGCCCAGCAAGGTCGGCGACGTT CTTGAGGAGATAGCCGACCTAATCGAGGGAAAGCTCGTCATTTCGGTCGTTGCCGGAGTCTCACTGAAGGAGTTAAAGCG CTTCGCGAAGGCGAAATTCGTGAGGGCGATGCCCAACATAGCGGTTCTCGTCGGCGAGTCTTTCACGGCCTACGCGACCG AGCTTGAGGGAGAGGAAGTTGAGCTGGTGGAAAGACTCCTGAGAACCTTCGGGGATTGCGTCCGCGTCGAGGAAGAGCAC ATGGACGCGATAACCGGGCTGAGTGGCTCTGGACCGGCCTACGT