tg1620

Coordinates:1522857-1523801

>tg1620 Prokaryotic ATPase, AAA superfamily
MKYYRYEEWQLKKHINDYFIIVTGPRWTGKSYFIREFMKRSNLNYIIIDAFKAWKEKKSWLERAIINDTKKSLRNRAPVG
VITSFRNVEAENFDNFRSFLRALKDETYVIIDHADYLRYARGIDFREVAQEWIDKRDKVHFVFVAKGTPALLSYLGPQDP
QSPLFMRYEKYVEVVELSPNETIKFLEDFLRLSKYMHSNFPDGFETYQDIGGLRGYLKKFVEVGCNEQKLRELLRNELKE
EIRGKNTWRVLEVIARYTRIYGYADKKIIEKKVGKNFDNLRKSIEESLINNGLVMPASSNTYKTPKILAKFLPQK

>tg1620 Prokaryotic ATPase, AAA superfamily
atgaaatattacagatacgaggagtggcaactcaaaaagcacatcaacgactacttcatcatagtgacaggccctcgctg
gactgggaaaagctactttatcagagagtttatgaaacgctcaaacctcaactatattatcattgatgcattcaaagcat
ggaaagagaagaaatcgtggcttgagcgagccatcataaacgacacaaagaagagccttcggaatagagccccagtaggg
gtcataacttcattccgaaatgtagaagcggagaactttgataacttcagaagtttcctacgggcactgaaagatgaaac
ctacgtaataatagaccacgccgattacctcagatatgctcgtggcatagacttcagagaagtcgcccaagaatggattg
acaaaagggacaaggtgcattttgttttcgtcgcaaaaggaactcccgcgttattgagctatcttggcccccaagatcca
caatctccgttatttatgagatatgagaaatacgttgaagttgttgaactctcaccaaatgagaccataaaattcctcga
agacttcttgagattgtcaaaatacatgcattcaaacttccccgatggatttgaaacgtatcaggacatcgggggacttc
gtggctatctgaaaaaatttgtcgaagttggttgcaatgagcagaagctccgagaactgctgagaaacgaactcaaagag
gaaatccggggcaaaaacacgtggagggttcttgaagtaattgcgaggtacacaaggatctatggttatgccgataaaaa
aatcatagaaaagaaagttggcaagaattttgacaatctcaggaagtctattgaagagtcactcatcaacaatggacttg
ttatgccggcttcatcaaatacatacaaaactccaaaaattctcgccaaatttttaccacagaaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1522357 - 1524301 (Additional range around tg1620 is :500nt.)

>Thermococcus gammatolerans EJ3 CTCCTACATGGCTTATTCAAAAGAATCCACGGTAACCCGAACCGGATAATCACAATATACCCATTCGAGCAAAAAGTCGC CACGGACTTTATTTTGAAAGGATTTGAACAGAATGATTTCCCTATCTCACGAGAAGAAGCAAAGGAGATATATAGCACAC TCGGGGGAACTCCCGGAGCTATAATTGCTGCAGCAGAACACATAATCCTCGAGGGGGAAGATATTGACACTGCCACTGAA CGAGAAAAAACCACTGAAATGAAGATGATGATAGAAGAACTCAACAATATAGCCAGCGAGTACACTGTTGAAACCCAATC ATTCGTGAAAAAGTTATCAATAAATGAATGGCAAATATATGATCTTTCATTCTTCACCGAAGATGAAAAGAAGCTCCTCG AAGATCTTATACGCTTTGGGTTTATCAAACCGAATGAAAAAGGTTACATAGTGTATGACCCACTCATAAGAGAGGCCCTG AAAGAATGGGGCGGTGTGAT atgaaatattacagatacgaggagtggcaactcaaaaagcacatcaacgactacttcat catagtgacaggccctcgctggactgggaaaagctactttatcagagagtttatgaaacgctcaaacctcaactatatta tcattgatgcattcaaagcatggaaagagaagaaatcgtggcttgagcgagccatcataaacgacacaaagaagagcctt cggaatagagccccagtaggggtcataacttcattccgaaatgtagaagcggagaactttgataacttcagaagtttcct acgggcactgaaagatgaaacctacgtaataatagaccacgccgattacctcagatatgctcgtggcatagacttcagag aagtcgcccaagaatggattgacaaaagggacaaggtgcattttgttttcgtcgcaaaaggaactcccgcgttattgagc tatcttggcccccaagatccacaatctccgttatttatgagatatgagaaatacgttgaagttgttgaactctcaccaaa tgagaccataaaattcctcgaagacttcttgagattgtcaaaatacatgcattcaaacttccccgatggatttgaaacgt atcaggacatcgggggacttcgtggctatctgaaaaaatttgtcgaagttggttgcaatgagcagaagctccgagaactg ctgagaaacgaactcaaagaggaaatccggggcaaaaacacgtggagggttcttgaagtaattgcgaggtacacaaggat ctatggttatgccgataaaaaaatcatagaaaagaaagttggcaagaattttgacaatctcaggaagtctattgaagagt cactcatcaacaatggacttgttatgccggcttcatcaaatacatacaaaactccaaaaattctcgccaaatttttacca cagaaa TGACAATCCCGCATACGGTATGTTCATAAATAAACATCAACGTCAATATTTGGCCACCACATGGGGGTATACA AACGTTTCAAAAACGTCCAATTCCCCGAGCCACATATCAGAAACAACAAAAACCCTTTTGACTATCAATTTCACTTCGCC AAGACTTTTTGTAAACCAAGTGCAAAAGTTTATTACCATGTTTTGACATATAATATGGGAATCCACATGAGTGTGTACAT ATATCTCCGCATAAGTACCGATAAACAAGACATCGACACCCAAATGGAATCAATAAAAGACTGGCTCAAGCGAAATAACG TCTCTGAGTACAAGATAATCAAAGACGAAGGCATCTCAGGAAGCACACCTGCAGAAAAACGCCCAGGTTTCTCCACTCTT CTCTCATTGCTCCAAGAGAACGACGTACTTATAGTCTCAGAACTCACGAGACTCGGCAGATCCCTCAGCGATGTCATTAT GACACTCAACAATCTCATGAAGAGAG