tg1621

Coordinates:1524021-1524683

>tg1621 Resolvase, putative
MSVYIYLRISTDKQDIDTQMESIKDWLKRNNVSEYKIIKDEGISGSTPAEKRPGFSTLLSLLQENDVLIVSELTRLGRSL
SDVIMTLNNLMKRGVRIVSIKEGLDSTQNELQFKVMSTLIALFADLEREFIRKRTIEGLQRAKAQGKRIGRPKALTEEDI
PVLVKLYEKGMTQKEIARAMKVSPSTIARTLKKLREQGVIEERRVVKVNKKKLKEVIDNAR

>tg1621 Resolvase, putative
atgagtgtgtacatatatctccgcataagtaccgataaacaagacatcgacacccaaatggaatcaataaaagactggct
caagcgaaataacgtctctgagtacaagataatcaaagacgaaggcatctcaggaagcacacctgcagaaaaacgcccag
gtttctccactcttctctcattgctccaagagaacgacgtacttatagtctcagaactcacgagactcggcagatccctc
agcgatgtcattatgacactcaacaatctcatgaagagaggcgtcagaatagtatcaatcaaggaaggacttgacagcac
acagaacgaactccaattcaaagtcatgagcactctcatagctctttttgcagacctcgaaagagaattcatccgaaaaa
gaaccattgaaggactacaacgagcaaaagcccaaggaaagagaataggaagaccaaaagcacttactgaggaggacatt
cctgtacttgtaaagctgtacgagaaaggaatgacacagaaggaaatcgcgagagcaatgaaagtgagcccatcaacaat
cgcacgaacactgaagaaactacgtgagcagggagtcatcgaggaacggagagtagtcaaagtaaacaagaagaaactga
aagaggtgatagacaatgcaaga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1523521 - 1525183 (Additional range around tg1621 is :500nt.)

>Thermococcus gammatolerans EJ3 AAGTTGGTTGCAATGAGCAGAAGCTCCGAGAACTGCTGAGAAACGAACTCAAAGAGGAAATCCGGGGCAAAAACACGTGG AGGGTTCTTGAAGTAATTGCGAGGTACACAAGGATCTATGGTTATGCCGATAAAAAAATCATAGAAAAGAAAGTTGGCAA GAATTTTGACAATCTCAGGAAGTCTATTGAAGAGTCACTCATCAACAATGGACTTGTTATGCCGGCTTCATCAAATACAT ACAAAACTCCAAAAATTCTCGCCAAATTTTTACCACAGAAATGACAATCCCGCATACGGTATGTTCATAAATAAACATCA ACGTCAATATTTGGCCACCACATGGGGGTATACAAACGTTTCAAAAACGTCCAATTCCCCGAGCCACATATCAGAAACAA CAAAAACCCTTTTGACTATCAATTTCACTTCGCCAAGACTTTTTGTAAACCAAGTGCAAAAGTTTATTACCATGTTTTGA CATATAATATGGGAATCCAC atgagtgtgtacatatatctccgcataagtaccgataaacaagacatcgacacccaaat ggaatcaataaaagactggctcaagcgaaataacgtctctgagtacaagataatcaaagacgaaggcatctcaggaagca cacctgcagaaaaacgcccaggtttctccactcttctctcattgctccaagagaacgacgtacttatagtctcagaactc acgagactcggcagatccctcagcgatgtcattatgacactcaacaatctcatgaagagaggcgtcagaatagtatcaat caaggaaggacttgacagcacacagaacgaactccaattcaaagtcatgagcactctcatagctctttttgcagacctcg aaagagaattcatccgaaaaagaaccattgaaggactacaacgagcaaaagcccaaggaaagagaataggaagaccaaaa gcacttactgaggaggacattcctgtacttgtaaagctgtacgagaaaggaatgacacagaaggaaatcgcgagagcaat gaaagtgagcccatcaacaatcgcacgaacactgaagaaactacgtgagcagggagtcatcgaggaacggagagtagtca aagtaaacaagaagaaactgaaagaggtgatagacaatgcaaga TAACTACGAAGAGCGCATAGCTGAGCTCGAACGCG AGATAGAAAAGCTCAAGCGAGAGCTGAACAAACTCAAAACTGGACAGGAATGGTATGAGAACGAACTCGAAGATCAAAAC AAGAGAATAACCATCATAGAACGAATCCTTGATGTTTACTACGATAGCGAAGCTTCAAAATGGCAAAGCAGGTACCTCAA GCGTATCTATGCTACGCTCAAAAAGCTTGAGCGAAAGCTTGAGCAGAAGAAAAATACAACCACGCAAAAGCAACTGCCCA CCTGAGTAGCTCAGCGTGTCTCCAGCATGTACTCGATGTAATATACTCGATACGATGCATAACCTTTTTATCCAGCCAGA TAGAAAGACCCCCTTGGTTGAGGGTAATGGTGGGAACTTTGAAACCCGGCTACATCCTCAAGAGCACGAAATGGAAGGAG CCTTTTCTCGTCGAGATCGTGAACGAAAGTGGAGACACCATCATGGTGGGAGGCCACTACCTGA