tg1632

Coordinates:1541676-1542524

>tg1632 xerC/D integrase/recombinase protein (xerC/xerD)
MKEENSTAIEEFATYLDLEGKSPNTIRMYTYYVRRYLEHGGGLDFRSALRFLARLRREGYSNRSLNLVVQALRAYFRFEG
LDEEAEKLKPPRVPKSLPKALTQEDVRKLLSVIPLTRRRDRLIVLLLYGAGLRVSELCNLKKEDIDLDRGIITVRGGKGA
KDRVVPIPPALTEEIKAYLSERDDDSEYLLVEVRRGTKDRLSPKTVWYLLNRYGKKAGVKVTPHMLRHSFATHMLERGVD
IRAIQELLGHSNLSTTQIYTKVTVEHLKKAQEKAKLLESLMEE

>tg1632 xerC/D integrase/recombinase protein (xerC/xerD)
atgaaagaagagaattcaacggccatcgaggagtttgcgacgtatcttgacctcgaggggaagagcccaaacacgatcag
aatgtacacgtactacgtcaggcggtacctcgagcacggcggggggcttgacttccgctctgccctccgttttctggccc
gcctgaggcgggaaggctactcaaacagaagtttaaacctcgttgtgcaggcgttaagggcctactttcgttttgaaggc
ctcgatgaggaagccgagaagctcaaaccgcccagggttccaaagagcctgccaaaggccctgacacaggaggacgtaag
aaagctgctttcggttatccccctcacgcgaagaagggacaggttgatagttcttctcctttacggggcaggattgcgtg
tcagcgagctctgcaacctgaagaaagaggatatcgaccttgacaggggcatcataaccgtccggggtggaaagggggcg
aaagaccgcgttgttccgatccccccggcactgacggaggagatcaaggcctacctcagcgagagggacgatgacagcga
atacctactcgtggaagtcagaagaggaaccaaggacaggctctcgccgaagactgtctggtacctgctcaaccgctacg
gcaagaaggccggcgttaaagtaacgccccacatgctcaggcacagcttcgcaacccacatgctggaaaggggggttgac
ataagggctatccaggagctcctcggtcattcaaacctctcaacgacacagatctacaccaaggtcactgtggaacacct
taaaaaggcccaggaaaaggcaaagctcctcgaaagcctaatggaagaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1541176 - 1543024 (Additional range around tg1632 is :500nt.)

>Thermococcus gammatolerans EJ3 GAGTACATGGAGCTCAGGAAAGAACTCCTCGACATCAAGGGGCACTACGAAGAGCTGGCTCACCAGTATGACGAACTGGA GCGTGAATACGAGGAGCTCAGGAAGAAGTACGAAGAGCTCAGGAGCGAGTACCTGAGTCTCAAGCAGGAGAACGAGAGCC TCCAGACCCTCCTCGAAAAGAAGAGCAGGCCGGTGAAGATAGAAGAAGCCTGGAAAGCCCTGTTCCCGGCCGAACCGGTA CCCCCGGAGGAGTTCCTGGCAATAGCGGTCGAAAAGCTCGGCCTCAACGGGAAGATCGTCGTCGGGCAGGGTTACATCTA CGCGGAGGAAGAGGAGGCGGTTGGAGAGCTCCTCAAGACTGTCTACCTCAGCATGGCGATCTCAAAGGAACTCGTTGAAA AGGAGAGACCTGAGGAAAAAGAACCAGAAAGGGGAAAGGAAGAGATCGAGGAAGACGTTAAAGCGACACTCTCAGGAACC GGGGAGGACTGAGGGTCGAG atgaaagaagagaattcaacggccatcgaggagtttgcgacgtatcttgacctcgaggg gaagagcccaaacacgatcagaatgtacacgtactacgtcaggcggtacctcgagcacggcggggggcttgacttccgct ctgccctccgttttctggcccgcctgaggcgggaaggctactcaaacagaagtttaaacctcgttgtgcaggcgttaagg gcctactttcgttttgaaggcctcgatgaggaagccgagaagctcaaaccgcccagggttccaaagagcctgccaaaggc cctgacacaggaggacgtaagaaagctgctttcggttatccccctcacgcgaagaagggacaggttgatagttcttctcc tttacggggcaggattgcgtgtcagcgagctctgcaacctgaagaaagaggatatcgaccttgacaggggcatcataacc gtccggggtggaaagggggcgaaagaccgcgttgttccgatccccccggcactgacggaggagatcaaggcctacctcag cgagagggacgatgacagcgaatacctactcgtggaagtcagaagaggaaccaaggacaggctctcgccgaagactgtct ggtacctgctcaaccgctacggcaagaaggccggcgttaaagtaacgccccacatgctcaggcacagcttcgcaacccac atgctggaaaggggggttgacataagggctatccaggagctcctcggtcattcaaacctctcaacgacacagatctacac caaggtcactgtggaacaccttaaaaaggcccaggaaaaggcaaagctcctcgaaagcctaatggaagaa TGAAAGGGA ACTCAATCCTCCCAGGGCTCCCTGTATTTCAGCGCCCAGCCGAACTCTTCCCTGAGGATGTCTATGGCAGCACTCGGCGG GATAACCCCGCGCTCGGTGATGATGACGTCAACGTACTCCGGTGGAGTAACGTCGAACGCTGGATTCCACACCGTTATGT TCTCAGGCCAGGTCTTAAGTTCTTCCTCGGGGATAACCTCGGTCGGGTCGCGCATCTCGATCTCGACGAGCTGGCCGAGC ATCGTCTCGGGGTGGAACTTGTAGGTTTCTGCCGCTATCATCGTCCAGACGCGGTGCTCCTTGGCGGTGAGGGCTATCAA GGCCGTTCCAATCTTGTTTATCACAGCGCCGTTCACTGTTATGCTGTCCGCGCCCATAACCACCTTGTCGGTCATCTTCA TATAGTGCCTCGCGGCACTGTCCACGACGTAGATGACAGGAATGCCGTAGCTGGCTAGTTCTTTGGCGGTGATCTTGCCC TGCCACTTGG