tg1639

Coordinates:1547381-1547836

>tg1639 hypothetical protein TGAM_1639
MGLRLTDILYLKSGRILMTGNPRRIARIILNEWAREGWRILAEGLPFQIEGDVFIGDPFENENFDVYLILNPLARTGNER
ERLHSWLDSHRDRLVVLYEHKYVGDSITRYPLRNFIDYLLAYRRETVGAEIVNLYRLENGRVVESSKLVRRR

>tg1639 hypothetical protein TGAM_1639
atgggactcaggctgacggatatcctttacctcaaatccggacggatcctcatgacgggcaatccgaggaggatagccag
aataatcctcaacgaatgggcaagggagggctggaggatactggctgaggggcttcccttccaaattgaaggggacgtct
tcattggagatcccttcgaaaatgagaactttgacgtttaccttatcctcaaccccctcgcgaggacgggaaatgagcgg
gaaaggcttcactcgtggctggactcgcaccgggacaggctggtcgttctgtacgagcacaagtacgttggtgactccat
aacccgttaccccctcagaaactttatagactacctcctcgcctacaggcgcgagaccgtaggcgctgagatcgttaacc
tgtacaggctcgagaacggaagggtcgtcgagtcctcaaagctcgtgagacgccga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1546881 - 1548336 (Additional range around tg1639 is :500nt.)

>Thermococcus gammatolerans EJ3 CTTCTTGGCCTTGGCGAGGGTTTCAAGGTTCTTGTAGTAGTCGTCCTCGCTGTTGCTCTGGAGTTCGACCAGTTCGAGGT TGAAGTCTTTGGCGGCTTTGGAGGCGCCGAGATAAGCCATGTCGTTGAAGCTGAGATCGCCCCTGCCACCCACGTCGTAA ACGATGGCTATAGCACCACTATAAGAGGCGCTGGAAGTGGTCTGGGAGTTCGTCTGACTGCTACTTTCGCTGGAGGTTTC TTTTTCCCCTCCTCCCCCGATGCAGCCGCTGGCCGCTACACTAAGGGCAACGAGCCCTACAACCAAAAGTGCAAACACGC TTTTCCATTTCATAGGGACACCCCTGAATACAGCTGTCGATCTGAGTGAGCAAAGACGGGATATATAGTTTGCGGTTTGC TAACCTGTAAAAGAAATCCCCTCACAAAACCCTAATCCTGATCGAAAGATTTTTGAGAGGGCTGCGTTATTAAGTTTAAC AACCTCTGGAGGAAAAGGG atgggactcaggctgacggatatcctttacctcaaatccggacggatcctcatgacgggc aatccgaggaggatagccagaataatcctcaacgaatgggcaagggagggctggaggatactggctgaggggcttccctt ccaaattgaaggggacgtcttcattggagatcccttcgaaaatgagaactttgacgtttaccttatcctcaaccccctcg cgaggacgggaaatgagcgggaaaggcttcactcgtggctggactcgcaccgggacaggctggtcgttctgtacgagcac aagtacgttggtgactccataacccgttaccccctcagaaactttatagactacctcctcgcctacaggcgcgagaccgt aggcgctgagatcgttaacctgtacaggctcgagaacggaagggtcgtcgagtcctcaaagctcgtgagacgccga TGA TGTGTGGCTTCGGGTCTGAAAGGTGATGACACCAGCTATCGCTGAGGCCGATAATGATATATATGAATAAGTTCCCCCGT GATCGGTGGTCAGGATGTTCGGAAAGCTCAGGGAGAAACTCAAGGGCTTCGTCAGGAGGGTCGAAGAGAACGTTGAGGAG GAAGAAAAAAAGATCGAGAAGGCTGAACCCGAGAAGAAGCCCGGTCTCTTTGAGAGGCTCCTCCAGGTCGAGATTAAGGA GAAGGACGTTGAGAGGGCTTTGGAGGATCTTGAGATCGAGCTTCTCGAGGCTGATGTGGCCCTGGAGGTCGTGGACGAGC TCAGGGAGAGCATAAAACGGAAGCTCGTCGGGAAAAAGGTCAAGATCGGTACGGACAAGGCCAAGGTCATTGAAGATGCC GTTAAGGAGGCCGTTCTTGAAGTTCTAACCCCGCCGAGAAAGATAAACCTTCTTGAGGAGATAAGGGCGAAAAAGGAGAA ACCCTACGTCATAGTCT