tg1643

Coordinates:1551914-1552798

>tg1643 ABC-type transport system, permease component
MDVGALMVILKNSLMAMVPIVLTSVGAAWSERAGVVSIGYEGVLLASAFFGAIFAEITGHASIGLLGGLFVGALFGMLHG
FLTVYLKGDHVIPGIGINLLAAGLVPFGIIAYWGTAGQHQLPFTLWHLKTRYGEFSPMILVTIAISIITWWVLFRTPLGL
RVRAVGENPEAADALGINVEKYRFWSTVYGHALAGLGGAYMSVDWLGMVHKTMSGGRGFIALANMVFSNWNPLVSLIGGW
LFGFFDGLATWLAPKHLVPEQFIYMLPYIMTIIIVAGIIGKARPPKWDGKPYKRE

>tg1643 ABC-type transport system, permease component
atggacgtcggggccctgatggtcattctgaaaaactctctgatggccatggttcctatagtgctaacaagtgtaggtgc
ggcgtggagcgagagggccggagtcgttagcataggctacgagggggttctcctcgcgagcgcgttctttggggcaatat
tcgcggagataacaggacacgcctccatcggactgcttggcgggctttttgttggggcactcttcggaatgctacacggc
ttcctgaccgtctacctcaagggagaccacgtaatccctggcatcggtataaacctcctcgccgctggactagttccctt
cggaatcatagcctactggggcaccgcaggccagcatcagcttccctttaccctgtggcacctgaaaacaaggtacggtg
agttcagcccgatgatactcgtcacgatagcgatatcgataatcacctggtgggtgctcttccggactccccttggcctg
cgcgtcagggcggttggtgagaacccggaggcagcagatgccctcggaataaacgtcgagaagtaccgcttctggtcaac
tgtctacggccacgccctggcaggtctcggcggggcttacatgagcgttgactggctcggaatggtgcacaagacgatgt
ccggtggaaggggcttcatagccctcgccaacatggtgttcagcaactggaatccgctcgtctcgctcatcggcggctgg
ctctttggcttcttcgatggactcgcaacgtggctcgctccaaagcacttggttccagagcagttcatctacatgctgcc
ctacataatgacgataatcatcgtcgcgggaataataggaaaggcaaggccaccgaagtgggatggaaaaccgtacaaga
gggag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1551414 - 1553298 (Additional range around tg1643 is :500nt.)

>Thermococcus gammatolerans EJ3 ATAGGGAACACGGTTCTCTCATGGGGTTTCATCATAGCGGTCATCGCCTCAGTTTCCATATACTTCATCCTGTGGCACAC CACACTGGGCTTTAGCATGAGGGCCAGCGGTTACAACGAGAAAGCAGCGAGATACGGTGGTATAAACCCCAAGATGGCTG TCCTCTGGTCATTTCTCATTGGTGGTATGATGAGCGGTCTGGGGGGTGCGATGAAAATAATGGGTGACTATCCCGGCTAT GCCATAAGTCAGGGAGGTGCCAACATTTACGGATTCGGTTTCGACGGAATAGGTGTTTCCCTCGTCGGAAGGAACCATCC CCTCGGCATAATCCTGTCCGCGATATTCTTTGGAATGTTAAAAGCCGGAACGTCTTCCATGCAGCAGACAGGGGTTCCCC TCGAGATAGTGAGGGTTATCCAGGGTGTGATAATCATAACCGTTGCCATTCCAAGCCTGTATGACCTTATAAAGAAGGCC TTAGGAAGGGGGGCTGCATA atggacgtcggggccctgatggtcattctgaaaaactctctgatggccatggttcctat agtgctaacaagtgtaggtgcggcgtggagcgagagggccggagtcgttagcataggctacgagggggttctcctcgcga gcgcgttctttggggcaatattcgcggagataacaggacacgcctccatcggactgcttggcgggctttttgttggggca ctcttcggaatgctacacggcttcctgaccgtctacctcaagggagaccacgtaatccctggcatcggtataaacctcct cgccgctggactagttcccttcggaatcatagcctactggggcaccgcaggccagcatcagcttccctttaccctgtggc acctgaaaacaaggtacggtgagttcagcccgatgatactcgtcacgatagcgatatcgataatcacctggtgggtgctc ttccggactccccttggcctgcgcgtcagggcggttggtgagaacccggaggcagcagatgccctcggaataaacgtcga gaagtaccgcttctggtcaactgtctacggccacgccctggcaggtctcggcggggcttacatgagcgttgactggctcg gaatggtgcacaagacgatgtccggtggaaggggcttcatagccctcgccaacatggtgttcagcaactggaatccgctc gtctcgctcatcggcggctggctctttggcttcttcgatggactcgcaacgtggctcgctccaaagcacttggttccaga gcagttcatctacatgctgccctacataatgacgataatcatcgtcgcgggaataataggaaaggcaaggccaccgaagt gggatggaaaaccgtacaagagggag TGATTCAGCCTTTCAGCACGTAGCCGAGGGCTGTGCCGAGGGAGAGACCAGCG AATAGGGCCGAAAGAACGTAGGCCAAGTCGTAACCGTTTCCTTTTTTCTCCACTTCAACCCTCTTTTCACCCACCGCCCT CAGAACGTTCACCGCATTCTCCCTGAGGACCTCCGTGTAAGGCCTGCCCTCCCAGAAAACAACAACCCCTGCCAAGGGCT TTCCGCTCTTTTCAGCAAGCTCAAACGCGGCGTTCCGAAGCTGAACCGGGCTCTGGAGGGAGTAAACTATCACATCGGAT TCCCCGGCAACGGGTACGAGCTCGTCCACGCCCCTGGCCGGCACTTCCTCCTCGGGTTTTATTGAGGCTATTGCCTTTAT TCCGAGCCACTCAACGGCGTACTGAACCGGGGGCATATTTATAACGGCGCTCTTGTTGGCAACGAAACCTGAAAAGGCCC ACTTTATGGCACTGACCTTCGTCCTGAAGATGTCGAAGTCCCTCCG