tg1647

Coordinates:1554852-1555208

>tg1647 hypothetical protein TGAM_1647
MPFLSQRKGFHNLFLSQNRAKTFFMLSLLGFGGEKMAWIEMIGLIGMLMLVGSWVPQTIETLRTKKCPLNMKFILIYFTA
STLLTIYAYLPPRDWIFTALNGLAAFQSGVNLYVKLRYS

>tg1647 hypothetical protein TGAM_1647
ttgccgtttctttctcaaaggaagggatttcataacctttttttgagccaaaatcgtgcaaaaaccttttttatgctctc
cctcctcgggtttggaggtgagaaaatggcgtggattgagatgataggcctgattggcatgctcatgctcgtcggctcgt
gggttccccagacgattgaaactctcagaaccaagaagtgccctctgaacatgaagttcatcctgatatacttcaccgca
tcgacgctgctgaccatctacgcgtaccttccaccgagggactggattttcacagccctcaacggccttgccgcctttca
gagtggggtcaacctctacgtcaagctccgctattcc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1554352 - 1555708 (Additional range around tg1647 is :500nt.)

>Thermococcus gammatolerans EJ3 AAAACCTCAACTGCGTTAGATGTTTGGGGGAAAGGCTATGCAGGTTTGGTACCGTTCACGTGCCCTCTACGACACGGTTA TGAGGCTCCTTAACTCGGGAAGGTACGATGCGGCCCTGGAAATGGCCGAACAGATCCCGGACGATAAGGTCAAGGCGAAG GCCTTCTCCAAGATAGCGGTTTACCTGGCCAGGGAGGGGAGGGATTATCGGGAGGCCCTCGAGAGGGCTATCAACGTCAC GTCCGATCTGCCATCCGGAGACGCCACCAAGGCCCTTATGAGCCTCGCCTTTGACTTCCTGTCGCTCGGACTTCACGAGG AGGCCCTTAGGGTAGCGGAGTTCATCAGGGATCTTTCCAACAGGTCGAAGATACAGGCGGAGGTTGCCTTAAAGCTCGCG AGGGAGGGCAAGGTTTCCGAGGCGATGAGGATAATAAACGACATCCTCGATGAGGACGTCAAGACGTGGGCCATGTCAAG GATGGCAACCACCGTTTAA ttgccgtttctttctcaaaggaagggatttcataacctttttttgagccaaaatcgtgca aaaaccttttttatgctctccctcctcgggtttggaggtgagaaaatggcgtggattgagatgataggcctgattggcat gctcatgctcgtcggctcgtgggttccccagacgattgaaactctcagaaccaagaagtgccctctgaacatgaagttca tcctgatatacttcaccgcatcgacgctgctgaccatctacgcgtaccttccaccgagggactggattttcacagccctc aacggccttgccgcctttcagagtggggtcaacctctacgtcaagctccgctattcc TGATTTCTTTCAGCGGAAAATT TAAATAGGACTTTCTCCCCCGTTTCTTAAGGGAAATCCAATGAAGAAGTTTCCTGCTAAGCTTGCTTCTTGGGAAGACAT TGAGAGATGGGCCAAGGAGGGGGCCTGGAAAGTTTTGGAGGACGGCTGGAGGCCTGACGTTATAGTCGGCCTTGCCCGCG GCGGCTGGGTTCCGGCAAGGCTCTACTGCGACTACCTCGGCGTGAAGGATTTGGTCAGCCTGAAGGTCGAGCACTGGGGT GTTACCGCAACCCCGGATGGCAAGGCCAGGCTCAAGTACGGCACCAGCTACGACTTGGGTGGCAAGAAGGTTCTCATCGT TGATGACATCAGCGACACGGGCGAGAGCTTAACCCTCGCCAAGAACTACGTCGAGAACCAGAAGCCTGCCGAGATAAGAA CAGCTACGCTCCTCACAATTAAGGGTTCGCGCTTCAAGCCCGACTACTTCGGCGAGGAAATCGACTGGGCGTGGATAG