tg1656

Coordinates:1561636-1562559

>tg1656 ABC-type transport system, ATPase component, putative multidrug transporter
MIKIENLVKTYRDVKALDGLNLEVKKGQIYGFLGPNGAGKSTTILSVLGLIYPQKGKIELFGQEIFRDGKYNEKRLVEAK
KKIGYMPEHATLWEFLTPMQTLDIIGESFGMSKEERARRSRELLELLNLWEVRNKKVGKFSKGMKQRLLLAQALINDPEL
LILDEPMTGLDPKGIAEFKDIIRRQKKEGKTVFFSSHILAHVEEVCDTVGVIVRGKLRVEDSIDNIKMSFLRKGGYLILL
ETDRPVEFKDVDWEIERVSPTKYKIKAPEDVRAQINDIVWSQGAKILQLMVRVPSLEEIFLKMVEEEG

>tg1656 ABC-type transport system, ATPase component, putative multidrug transporter
atgatcaaaatagagaacctcgttaaaacttatagggacgtgaaagccctcgatggcctaaacctcgaggtaaagaaagg
acagatatacggcttccttggaccgaacggggccggaaagagcaccacgatactgagcgtcctcggactgatatacccgc
agaaagggaagatagaactcttcggccaggagatcttcagagatgggaagtacaacgagaaaaggctggttgaggccaag
aagaagataggctacatgcccgaacacgcaaccctctgggaattcctcactccgatgcagacactggacatcattggaga
gtctttcgggatgtcgaaagaggagagagccaggaggagcagagagcttttggagctcctcaacctctgggaggtacgga
acaagaaggttggcaagttctcaaagggaatgaagcagaggctcctcctggcacaggcgctaataaacgacccggagctc
ctcatactggatgagccaatgacgggccttgatcccaaggggatagcagagttcaaggacataataaggaggcagaagaa
ggaggggaagacggttttcttctcatcccatatactggcccacgttgaggaggtctgcgacaccgttggggtcatcgtca
gggggaagctccgcgtcgaggacagcatagacaacataaagatgagcttcctgaggaagggcggttatctgatcctcttg
gaaacggacaggcccgttgagttcaaggacgttgactgggaaatagagcgcgtcagcccaaccaagtacaagataaaagc
accggaagacgtcagggcacagataaacgatatagtgtggagccagggggcgaagatcctccagctcatggtcagggtgc
ccagcctagaagaaatattcctgaagatggtggaagaggagggc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1561136 - 1563059 (Additional range around tg1656 is :500nt.)

>Thermococcus gammatolerans EJ3 AGAGAGGGCTTTCTCTATCGCAATGAAAGCGTCAAATCGCCTTATGAGTACATGAACATACAGTACAACAGGCTCGTTAA GGAGTATAAGAGGAAGTACCTCTTCTTCGATCCTATAACCCAGCTCAACTTCCTCCTTGGTAACCTCACCAAAAAGATTC ACGTGACGATAACCAACGAGACGTACTATCCAATGAAAAAGGAAGGGCTAACTATAGTGACTGACTACGAGCACCCAATC AAGAGTAATGTAACGAACACCACCGGCGAGGGTCCGTGCCAGGGGCCTGACGTTGAGGGAGGTAGCAGAACCGAGAACAT AAACGGAACGTACGTGGAAGTCAGGTACGAGAAGCGCTGCTACACCCTGGAGACCTACCAGGGGGTCGGTTACTCAATCA AGAAGAACCTTGACAGGCTTGGGGTGATGATAGCAATGCTGATCCTCTACCTGGGCGTAGGCTTCTACCGCTTCCTCCGC ATGGATCTGAGGTGATGACG atgatcaaaatagagaacctcgttaaaacttatagggacgtgaaagccctcgatggcct aaacctcgaggtaaagaaaggacagatatacggcttccttggaccgaacggggccggaaagagcaccacgatactgagcg tcctcggactgatatacccgcagaaagggaagatagaactcttcggccaggagatcttcagagatgggaagtacaacgag aaaaggctggttgaggccaagaagaagataggctacatgcccgaacacgcaaccctctgggaattcctcactccgatgca gacactggacatcattggagagtctttcgggatgtcgaaagaggagagagccaggaggagcagagagcttttggagctcc tcaacctctgggaggtacggaacaagaaggttggcaagttctcaaagggaatgaagcagaggctcctcctggcacaggcg ctaataaacgacccggagctcctcatactggatgagccaatgacgggccttgatcccaaggggatagcagagttcaagga cataataaggaggcagaagaaggaggggaagacggttttcttctcatcccatatactggcccacgttgaggaggtctgcg acaccgttggggtcatcgtcagggggaagctccgcgtcgaggacagcatagacaacataaagatgagcttcctgaggaag ggcggttatctgatcctcttggaaacggacaggcccgttgagttcaaggacgttgactgggaaatagagcgcgtcagccc aaccaagtacaagataaaagcaccggaagacgtcagggcacagataaacgatatagtgtggagccagggggcgaagatcc tccagctcatggtcagggtgcccagcctagaagaaatattcctgaagatggtggaagaggagggc TAAAGCCTGGCCCT CTCGAACTCCTCTTTTCTTTCCAGCGGTTTCGTCGCGTCTATACCCCACTTGGCAGTTAAGCTCTTCTCCGCCGAGGGGT CGAGGGAGCTACCGCGGGCGTTGGGGACTATCACGAGGTCCCTATCTGCCTGGAAGCGCGTCGCTATGGCCCACTCCACG TCGCGGTCGTCGTAGATGTCTATGTCCTCATCAACGACAACGACGTGTTTGAGGCTCGGGTGGCCGGCGAAAGCCGCTAA AATCGCGTTCTTGCCGTCGCCGTCGTGCTGTTTTGTTATTGAAACGACCGCATGAAGCCACATGGCCCCTCCTTCCGTCA GCCGAACGCCGTGAACCTTGGGAACCACGCGCTTGACGCTCGCGTAGATTTGAGGCTCCTTGGGGAGGCCCATGAGCATG AAGTGCTCGTAGCCTCCGGGCAGAAGGGCGTGGAAAATCGGGTCATCAACGTGGTACATCCGCTCAAAGACGACCAAAGG TTGCT